KEGG   Streptomyces scabiei: SCAB_49941Help
Entry
SCAB_49941        CDS       T01187                                 

Gene name
gpmA
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
scb  Streptomyces scabiei
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAB_49941 (gpmA)
   01230 Biosynthesis of amino acids
    SCAB_49941 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAB_49941 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SCAB_49941 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAB_49941 (gpmA)
Enzymes [BR:scb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SCAB_49941 (gpmA)
Exosome [BR:scb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SCAB_49941 (gpmA)
  Exosomal proteins of melanoma cells
   SCAB_49941 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5570513..5571274
Genome map
AA seq 253 aa AA seqDB search
MADAPYKLILLRHGESEWNEKNLFTGWVDVNLTPKGEKEATRGGELLKDAGLLPDVLHTS
LQRRAIRTAQLALESADRHWIPVHRSWRLNERHYGALQGKDKAQTLAEFGEDQFMLWRRS
YDTPPPPLADDSEFSQASDARYATIPPELRPRTECLKDVVVRMLPYWYDGIVPDLLAGRT
VLVAAHGNSLRALVKHLDGVSDADIAGLNIPTGIPLSYELDADFKPLNPGGTYLDPDAAA
AAIEAVKNQGKKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcaccgtacaagctgattctcctccgccacggcgagagcgagtggaacgag
aagaacctgttcaccggctgggtggacgtcaacctcacgccgaagggagagaaggaggcg
acgcgcggcggtgagctgctgaaggacgccggcctgctcccggacgtgctccacacctcc
ctccagaggcgcgccatccgcaccgcgcagctggccctggagtccgccgaccgccactgg
attccggtacaccgttcgtggcgcctgaacgagcgccactacggtgccctccagggcaag
gacaaggcgcagacgctcgccgagttcggcgaggaccagttcatgctgtggcgccgctcg
tacgacaccccgccgcccccgctcgcggacgactcggagttctcccaggcctcggacgcg
cgctacgcgaccatcccgccggagctccgcccccgcacggagtgcctgaaggacgtcgtg
gtccgcatgcttccgtactggtacgacggcatcgtccccgacctcctcgcgggccgcacg
gtcctcgtcgccgctcacggcaactccctgcgcgccctggtcaagcacctcgacggcgtc
tcggacgccgacatcgcgggcctcaacatccccaccggcatcccgctctcctacgaactg
gacgccgacttcaagcccctcaaccccggcggcacctacctcgacccggacgccgcggcg
gcggcgatcgaggcggtcaagaatcagggcaagaagaagtaa

DBGET integrated database retrieval system