KEGG   Streptomyces scabiei: SCAB_50341Help
Entry
SCAB_50341        CDS       T01187                                 

Definition
(GenBank) putative ROK-family regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
scb  Streptomyces scabiei
Pathway
scb00010  Glycolysis / Gluconeogenesis
scb00052  Galactose metabolism
scb00500  Starch and sucrose metabolism
scb00520  Amino sugar and nucleotide sugar metabolism
scb00521  Streptomycin biosynthesis
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01120  Microbial metabolism in diverse environments
scb01130  Biosynthesis of antibiotics
scb01200  Carbon metabolism
Module
scb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAB_50341
   00052 Galactose metabolism
    SCAB_50341
   00500 Starch and sucrose metabolism
    SCAB_50341
   00520 Amino sugar and nucleotide sugar metabolism
    SCAB_50341
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCAB_50341
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SCAB_50341
Enzymes [BR:scb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SCAB_50341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: CBG72080
UniProt: C9ZH55
Position
complement(5609267..5610247)
Genome map
AA seq 326 aa AA seqDB search
MRHVIALDVGGTGMKAALVGAGPVPGAPPVLLHQTRRATGRERGAEAVVGSILDFAAELR
AHGERHFGEPAAAAGVAVPGIVDSGRGIAVYAANLGWRDVPLRALLAERLGGVPVALGHD
VRTGGLAEGRVGAGRGADRFLFVALGTGIAGAIGVDGRVEAGAHGFAGEIGHVVVRPGGT
PCPCGQRGCLERFASAAAVSEAWAAACGDPGADAADCAKAVESGDPRAVAVWGHAVDALA
DGLVTALTLLDPRTLIIGGGLAEAGDTLFGPLRTAVENRVTFQKVPTIVPAALGDTAGSL
GAGLMAWDLIAPAHPATPTDLPEVTP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgagacatgtcatcgccctcgatgtgggcggcaccgggatgaaggccgcactggtcggg
gccggccccgtgcccggcgcaccccccgtgctgctgcaccagacgcggcgcgccaccgga
cgcgagcgcggggcggaggcggtggtcggctcgatcctcgacttcgccgccgagctgcgt
gcccacggcgagcggcacttcggcgagcccgcggccgccgccggggtcgccgtgccgggc
atcgtcgactccggccggggcatcgccgtctacgccgccaatctcggctggcgcgacgtc
ccgctgcgcgcgctcctcgccgaacgcctcggcggcgtcccggtcgccctcggccacgac
gtgcgcaccggcgggctcgcggaggggcgcgtgggagcgggccggggcgccgaccgcttt
ctcttcgtggcactcggcaccgggatcgccggcgcgatcggcgtcgacggccgggtggag
gccggcgcccacggcttcgcgggcgagatcggccacgtcgtcgtacggcccgggggcacc
ccgtgcccgtgcgggcagcgcggctgtctggaacggttcgcctccgcggcggccgtcagc
gaggcatgggcggcggcctgcggcgaccccggggccgacgcggcggactgcgccaaggcc
gtcgagtcgggcgacccgcgcgccgtcgccgtctgggggcacgcggtcgacgccctcgcc
gacggtctcgtcaccgccctcaccctgctcgacccccgcaccctcatcatcggcggcggt
ctggcggaggccggtgacaccctgttcggtcctctccgcaccgcggtggagaaccgggtg
accttccagaaggtccccaccatcgtgcccgcggccctgggcgacaccgcgggcagcctg
ggcgcgggcctgatggcctgggacctgatcgcccccgcgcaccccgccacccccacggac
ctcccggaggtaaccccctga

DBGET integrated database retrieval system