KEGG   Streptomyces scabiei: SCAB_50401Help
Entry
SCAB_50401        CDS       T01187                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
scb  Streptomyces scabiei
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCAB_50401
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAB_50401
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCAB_50401
Enzymes [BR:scb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCAB_50401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5616099..5617415
Genome map
AA seq 438 aa AA seqDB search
MRRKGLASMAAQTVASTTDSPSTVDLGPAAALSCRECGHRVPLGPVFACEECFGPLEIAY
DYSAYDTEELRKRIESGPANIWRYAPLLPVPADVATKPNINPGWTQLVQADNLAAALGVD
AGKLFVKDDSGNPTHSFKDRVVAQALEAARAFGFTTLSCSSTGNLAGAVGAAAARAGFRS
CVFIPHDLEQGKVVMAAVYGGELVGIEGNYDDVNRFCSELIGDPAGEGWGFVNVNLRPYY
AEGSKTLAYEICEQLGWQLPDQLVVPIASGSQLTKIDKGLQELIKLGLVEDKPYKIFGAQ
AEGCSPVSVAFKAGHDVVRPQKPNTIAKSLAIGNPADGPYVLDIARRTGGAVEDVTDEQV
VEAIKLLARTEGIFAETAGGVTVGVTKKLIEDGLLDPTLTTVVLNTGDGLKTLDAVAGTG
LTATIRPSLDSFREAGLV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaggagaaagggcctcgcctccatggctgcgcagactgttgcaagcaccaccgactcc
ccctccacagtagacctcggcccggccgccgcactgagctgtcgtgagtgcggtcaccgc
gtccccctcggaccggtcttcgcctgcgaggagtgtttcgggccgctggagatcgcgtac
gactactccgcgtacgacacggaggagctgcgcaagcggatcgagtccgggccggcgaac
atctggcggtacgcgcccctgctgcccgtcccggccgacgtggcgaccaagccgaacatc
aatcccggctggacccagctcgtgcaggccgacaacctggccgccgcgctcggcgtcgac
gccggaaagctcttcgtcaaggacgactccggcaaccccacgcactccttcaaggaccgt
gtcgtcgcccaggcgctggaggcggcccgcgccttcggcttcaccacgctgtcctgctcc
tccacgggcaacctggccggtgccgtcggcgccgccgccgcccgcgccggcttccggtcc
tgcgtgttcatcccgcacgacctggagcagggcaaggtcgtcatggccgcggtctacggc
ggcgagctggtcggcatcgagggcaactacgacgacgtgaaccgcttctgctccgagctg
atcggcgacccggccggcgagggctggggcttcgtgaacgtcaacctgcggccgtactac
gcggagggctccaagaccctggcgtacgagatctgcgagcagctcggctggcagctcccc
gaccagctggtcgtgccgatcgcctccgggtcgcagctcaccaagatcgacaaggggctg
caggagctgatcaagctcgggctcgtcgaggacaagccgtacaagatcttcggtgcgcag
gccgagggctgctcgccggtgtcggtggccttcaaggccgggcacgacgtggtgcggccg
cagaagccgaacaccatcgcgaagtcgctggcgatcggcaacccggcggacgggccgtac
gtgctcgacatcgcgcggcggaccggcggggccgtggaggacgtgacggacgagcaggtc
gtcgaggcgatcaagctgctcgcgcggaccgaggggatcttcgccgagaccgccggtggt
gtgaccgtcggcgtgacgaagaagctgatcgaggacgggctgctggacccgacgctcacc
acggtcgtgctcaacacgggggacggcctcaagacgctggacgcggtggcggggacgggg
ctcaccgccaccatccggcccagccttgattcgttccgtgaggccggccttgtctaa

DBGET integrated database retrieval system