KEGG   Streptomyces scabiei: SCAB_51311Help
Entry
SCAB_51311        CDS       T01187                                 

Gene name
echA12
Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
scb  Streptomyces scabiei
Pathway
scb00071  Fatty acid degradation
scb00280  Valine, leucine and isoleucine degradation
scb00281  Geraniol degradation
scb00310  Lysine degradation
scb00360  Phenylalanine metabolism
scb00362  Benzoate degradation
scb00380  Tryptophan metabolism
scb00410  beta-Alanine metabolism
scb00627  Aminobenzoate degradation
scb00640  Propanoate metabolism
scb00650  Butanoate metabolism
scb00903  Limonene and pinene degradation
scb00930  Caprolactam degradation
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01120  Microbial metabolism in diverse environments
scb01130  Biosynthesis of antibiotics
scb01212  Fatty acid metabolism
Module
scb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCAB_51311 (echA12)
   00650 Butanoate metabolism
    SCAB_51311 (echA12)
  Lipid metabolism
   00071 Fatty acid degradation
    SCAB_51311 (echA12)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCAB_51311 (echA12)
   00310 Lysine degradation
    SCAB_51311 (echA12)
   00360 Phenylalanine metabolism
    SCAB_51311 (echA12)
   00380 Tryptophan metabolism
    SCAB_51311 (echA12)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCAB_51311 (echA12)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCAB_51311 (echA12)
   00281 Geraniol degradation
    SCAB_51311 (echA12)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCAB_51311 (echA12)
   00627 Aminobenzoate degradation
    SCAB_51311 (echA12)
   00930 Caprolactam degradation
    SCAB_51311 (echA12)
Enzymes [BR:scb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SCAB_51311 (echA12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CBG72173
UniProt: C9YTM4
Position
5708331..5709077
Genome map
AA seq 248 aa AA seqDB search
MTDPHPLVRTAHHRGITTLTLDSPANRNALSAALVAEFRDALDACGKDDTVRAVVLTHTG
GTFCAGADLRDPPDPAALVALLRLLLELPKPVVARVTGHVRAGGLGLLGACDIAAAGPEA
TFALTEVRIGVAPAVISLTLRPRTDPRALARYYLTGERFGPAEAARIGLITDAGAEVDDV
LAPVLDGLRRASPRALAETKHLLTAKVLENFDQDAGELTRLSSRLFASADAREGMTAFLE
RREPGWVL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacccccaccccctcgtacgcaccgcgcaccaccggggcatcaccaccctcacc
ctcgactccccggccaaccgcaacgcgctctcggccgccctcgtcgccgaattccgcgac
gccctcgacgcgtgcggcaaggacgacaccgtacgagccgtcgtcctcacccacaccggc
ggcaccttctgcgccggtgccgacctgcgcgacccgcccgacccggcggccctggtcgct
ctcctgcgcctgctcctggaactgcccaagcccgtcgtcgcccgggtcaccgggcacgtc
cgcgcgggcggcctcggcctgctcggggcctgcgacatcgccgccgccggacccgaggcc
accttcgccctcaccgaggtccgcatcggggtcgcgcccgccgtcatctcgctcaccctg
cgcccccgcaccgacccgcgcgccctcgcgcgctactacctcaccggcgagcgcttcggc
cccgccgaagccgcccgcatcgggctgatcaccgacgcgggcgccgaggtcgacgacgtg
ctcgcacccgtcctcgacggactgcgccgggcctcacccagggccctggcggagacgaaa
cacctgctcacggctaaggtgctggagaacttcgaccaggacgcgggcgaactgacccgg
ctctcgtcccggctgttcgcctccgccgacgcccgcgagggcatgacggccttcctcgaa
agacgggaaccgggatgggtgctgtga

DBGET integrated database retrieval system