KEGG   Streptomyces scabiei: SCAB_53131Help
Entry
SCAB_53131        CDS       T01187                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
scb  Streptomyces scabiei
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCAB_53131 (gtaB)
   00052 Galactose metabolism
    SCAB_53131 (gtaB)
   00500 Starch and sucrose metabolism
    SCAB_53131 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    SCAB_53131 (gtaB)
Enzymes [BR:scb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SCAB_53131 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5900258..5901169
Genome map
AA seq 303 aa AA seqDB search
MSEANPRISKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAASAGLDDVLMI
TGRNKRPLEDHFDRNYELESALQKKGDAHRLAKVQESSDLATMHYVRQGDPRGLGHAVLC
AAPHVGDEPFAVLLGDDLIDPRDPLLKRMVQVQEEHGGSVIALMEVAPEQIHLYGCAAVE
ATVDGDVVKVTGMVEKPEAADAPSNYAIIGRYVLAPQIFEVLSRTEPGRGGEIQLTDALQ
QLAADEKVGGPVHGVVFKGRRYDTGDRGDYLRAIVRLACEREDLGPDFRTWLRSYVAEEM
EPQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggcgaaccccaggatcagcaaggctgtcatccccgccgcgggtctgggaacc
cggttcctgccggccaccaaggcgactcccaaggagatgctgccggtggtcgacaagccg
gcgatccagtacgtggtggaggaggccgcgtcggcgggtctcgacgacgtactgatgatc
accggccggaacaagcgcccccttgaggaccacttcgaccgcaactacgagctggagtcg
gccctccagaagaagggcgacgcccaccggctcgccaaggtccaggagtccagcgacctc
gcgaccatgcactacgtccgccagggcgaccccaggggcctcggccacgccgtcctgtgc
gccgcgccccacgtcggcgacgaacccttcgcggtcctcctcggcgacgacctgatcgac
ccccgcgacccgctcctgaagcgcatggtccaggtccaggaggagcacggcggcagcgtc
atcgcgctcatggaggtcgcgccggaacagatccacctctacggctgcgccgccgtcgag
gccacggtcgacggagacgtcgtcaaggtcacgggcatggtcgagaagccggaggccgcc
gacgccccgtccaactacgcgatcatcggccggtacgtcctggccccgcagatcttcgag
gtgctgagccgcaccgagccgggccgcggcggcgagatccagctcaccgacgccctccag
cagctcgccgcggacgagaaggtcggcggccccgtgcacggcgtcgtcttcaagggccgc
cgctatgacaccggtgaccgtggcgactacctgcgtgccattgtcagactcgcatgcgaa
cgtgaggacctgggcccggacttccggacctggcttcgcagttacgtagccgaggagatg
gagccacagtga

DBGET integrated database retrieval system