KEGG   Streptomyces scabiei: SCAB_53871Help
Entry
SCAB_53871        CDS       T01187                                 

Definition
isopentenyl monophosphate kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
scb  Streptomyces scabiei
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCAB_53871
Enzymes [BR:scb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SCAB_53871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5977591..5978505
Genome map
AA seq 304 aa AA seqDB search
MSVTVRVPAKVNVQLAVGGARPDGFHDLANVFLAVGLYDEVTATPADELTVTCAGPGADQ
VPLDRTNLAARAALALAERHGVEPAVHLHIAKDIPVAGGMAGGSADAAGALLACDTLWGT
NASRDELLDMCAELGSDVPFSLVGGAALGTGRGEQLRPLDVGGTFHWVFAVADGGLSTPA
VYREFDRLHADDTVPEPVASQVLLDALAKGDADALAAFLPDSNGLQPAALSLFPKLADTL
TAGRAAGALAALVSGSGPTTAFLARDADAAHSVAAELLASGTCRTARVAVSPAPGATVVR
GAQD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcaccgttcgcgtccccgccaaggtcaacgtgcagctcgcggtcggcggtgcc
cggcccgacggcttccacgacctggccaacgtcttcctcgccgtcggtctgtacgacgag
gtcaccgcgacgccggccgacgagctgaccgtcacctgcgcgggccccggcgccgaccag
gtccccctggaccggacgaacctcgccgcgcgggccgccctcgcgctggcggaacgccac
ggcgtcgagccggccgtgcatctgcacatcgccaaggacatcccggtggccggcggcatg
gccggcggcagcgcggacgcggccggtgcgctcctcgcctgcgacacactgtggggaaca
aacgcctcgcgcgacgaactcctcgacatgtgcgccgagttgggcagcgacgtgccgttc
agcctggtgggcggggcggccctcggcaccggacggggcgagcaactccggcccctcgac
gttggcggcaccttccactgggtgttcgccgtcgccgacggagggctctccacgcccgcc
gtctaccgcgagttcgaccggctgcacgcggacgacaccgtccccgagcccgtcgcctcc
caggtcctgctcgacgcgctcgccaagggggacgccgacgcgctggccgccttcctgccg
gactccaacggcctccagcccgcggcgctctcgctcttcccgaagctggccgacaccctc
accgccggccgcgcggccggcgcgctcgccgcgctcgtctccggctcgggcccgaccacg
gccttcctcgcccgggacgccgacgcggcccactccgtcgccgcggagctgctcgcgtcc
ggcacctgccggacggcgcgggtcgccgtctcccccgcgccgggggcgaccgtcgtccgg
ggcgcccaggactag

DBGET integrated database retrieval system