KEGG   Streptomyces scabiei: SCAB_54101Help
Entry
SCAB_54101        CDS       T01187                                 

Definition
membrane-bound fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
scb  Streptomyces scabiei
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:scb01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:scb01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6006655..6007671)
Genome map
AA seq 338 aa AA seqDB search
MIDDAPNAHGSPGSPAAGSPAPSATLGGEQKRSIEQITLLLFIIVPFLAVVAAVPLAWNF
GGVSWLDLGLLVFFYYLGCHGITIGFHRHFTHGAFKARRPLKIALAIAGSMAVEGPLVRW
VADHRKHHKFSDADGDPHSPWRFGETMPALLKGLWWAHIGWMFDEEQTPQEKYAPDLIKD
PALRAISRQFIFWAMLSLALPPLIGGLVTMSWWGAFTAFFWGSLVRVALLHHVTWSINSI
CHAVGKRPFKSRDRSGNVWWLAILSCGESWHNLHHADPTSARHGVERGQLDSSARLIRWF
EVFGWAYDVRWPSRSRIDSRRKTGEDGSEHRTAAAEAA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgacgacgccccgaacgcacacggttcgccaggttccccggcagccggctcgccc
gcgccgtcggccacgctgggcggcgaacagaagcgttcgatcgagcagatcacgctgctc
ctcttcatcatcgtccccttcctcgcggtcgtcgcggcagtgccgctggcctggaacttc
gggggcgtgagctggctggacctcggcctgctggtgttcttctactacctggggtgccac
ggcatcacgatcggcttccaccggcacttcacccacggtgcgttcaaggccagacgccca
ctgaagatcgcgctggcgatcgccggctcgatggccgtcgagggcccgctggtgcgctgg
gtggccgaccaccgcaagcaccacaagttctccgacgccgacggtgacccccactcgccg
tggcgcttcggcgagacgatgcccgcgctgctgaagggcctgtggtgggcccacatcggc
tggatgttcgacgaggagcagacgccgcaggagaagtacgcccccgacctgatcaaggac
ccggcgctccgcgcgatctcccgccagttcatcttctgggcgatgctctccctcgccctg
ccgccgctgatcggcggcctggtgacgatgtcctggtggggcgcgttcacggcgttcttc
tggggctcgctcgtccgggtggcgctgctgcaccacgtgacctggtcgatcaactcgatc
tgccacgcggtcggcaagcgccccttcaagtcccgcgaccgctcgggcaacgtgtggtgg
ctggcgatcctttcctgcggcgagtcctggcacaacctgcaccacgccgatcccacttcc
gcccggcacggtgtggagcgcggacagctggactcctccgcgcggctgatccgctggttc
gaggtgttcggctgggcgtacgacgtccgctggccgtcacgctcgcgtatcgattccagg
cgcaagacgggtgaggacggctccgagcaccggacggcggccgccgaggcggcatga

DBGET integrated database retrieval system