KEGG   Streptomyces scabiei: SCAB_55881Help
Entry
SCAB_55881        CDS       T01187                                 

Definition
transcriptional regulator
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
scb  Streptomyces scabiei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:scb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6234464..6235618
Genome map
AA seq 384 aa AA seqDB search
MDRMDRTAPTDHGPLAGFTVGVTAARRADELGALLQRRGAAVLHAPALRIVPLADDSELL
AATKDLLDQAPDIVVATTAIGFRGWIEAADGWGLGEALLDRLRGVELLARGPKVKGAIRA
AGLTEEWSPSSESMAEVLDRLLEQGVEGRRLAIQLHGEPLPGFVESLRAAGAEVVGVPVY
RWMPPEDITPMDRLLDAAIGRGLDALTFTSAPAAASLLSRAEDRGLLPELLNALGHDVLP
ACVGPVTALPLQAHGVDTVQPERFRLGPLVQLLCQELPGRARTLPIAGHRVEIRGHAVLV
DGDLRPVPPAGMSLLRALCRRPGWVVPRSDLLKALPGAGRDEHAVETAMARLRTSLGTPK
LIQTVVKRGYRLALDPTADTKYDT
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggatcggatggatcggacagcgccgacggaccacgggccgctcgcgggcttcaccgtg
ggcgtcacggccgcccgccgggccgacgagctgggagcactgctccagcgccgcggagcc
gcggtcctgcacgcccccgccctgcgcatcgtgccgctcgccgacgacagcgaactgctc
gccgcgaccaaggacctgctcgaccaggcccccgacatcgtggtggcgaccacggcgatc
ggcttccgcggctggatcgaggcggcggacggctggggcctcggggaggcgctcctcgac
cggctgcggggcgtcgaactcctcgcgcgcggaccgaaggtgaagggtgccatccgcgcc
gccggactcaccgaggagtggtccccctcctccgaatccatggccgaggtgctcgaccgg
ctgctggagcagggcgtcgagggccgtcgtctcgccatccagctccacggcgaacccctc
cccggcttcgtggagtccctgcgggccgccggagcggaggtcgtgggtgtccccgtgtac
cgctggatgccccccgaggacatcacccccatggaccgcctcctcgacgcggcgatcggc
cgcggcctcgacgccctcaccttcaccagcgccccggcggcggcctccctgctctcccgc
gccgaggaccggggcctgctcccggagctgctcaacgccctcggccacgacgtcctcccc
gcctgcgtgggcccggtgacggcactgcccctccaggcccacggcgtggacacggtccag
cccgagcggttccgcctcggccccctggtccagctcctgtgccaggaactccccggccgc
gcccgcacgttgcccatcgccggccaccgggtggagatccggggccacgcggtcctcgtc
gacggcgacctccgccccgtccctccggcgggcatgtccctgctgcgcgcgctctgccgc
cgtccgggctgggtcgtcccccgctcggacctcctcaaggccctccccggcgccggccgc
gacgaacacgccgtggaaacggccatggcccgcctccgcacatccctgggcacccccaaa
ctcatccagacagtggtcaaacgcggctaccgcctggccctggacccaacggcggacacg
aagtacgacacgtaa

DBGET integrated database retrieval system