KEGG   Streptomyces scabiei: SCAB_56011Help
Entry
SCAB_56011        CDS       T01187                                 

Definition
sugar hydrolase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
scb  Streptomyces scabiei
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCAB_56011
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SCAB_56011
Enzymes [BR:scb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SCAB_56011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6249153..6250811
Genome map
AA seq 552 aa AA seqDB search
MKRTDPMTTDRTGTDLIPAPLAVEGPLRRGVPLDGNTTLWAAPGTEDTARWLRSTVGAAL
GLSLPPGPEDARDAVRLCLDDGLAPEEYRLGAAPDRGIEIRGGGPAGVFWGAQTLRQLLG
PEAFRRAPVRPGGTYGVPHQTVRDAPRFAWRGLMLDVARHFLPKDQVLRYVDLMAAHKLN
VLHLHLTDDQGWRIEIERYPRLTEVGSWRARTRFGHRASPLWEEKPHGGHYTKDDLREIV
AYAAARHITVVPEIDVPGHSQAAIAAYPELGNTDVVDTAALTVWDTWGISTNVLAPTDGT
LRFYEGVFEEVLELFPSPFVHIGGDECPKDQWRGSATAQARVRELGLADEDALQSWFVRH
FDNWLTARGRRLIGWDEILQGGLAPGAAVSSWRGYAGGITAARAGHDVVMCPEQQVYLDH
RQDGGPDEPVPIGWVRTLEDVFRFEPVPPELTPDEARHVLGTQANVWTEAMEDAARVDYQ
TFPRLAAFAEVAWSRLPAPAERDFADFERRMAAHYRRLDALGVGYRPPSGPRPWQRRPGV
LGRPIEGKPPNV
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggacggacccgatgaccaccgaccggaccggaaccgacctgatcccggcgccg
ctggccgtcgagggccccctgcgccgcggtgtaccgctcgacgggaacaccaccctgtgg
gcggcgccgggcaccgaggacaccgcccgctggctgcgctcgaccgtcggcgccgccctc
gggctgtccctgccgcccggccccgaggacgcccgcgacgccgtacgcctgtgcctcgac
gacggcctggcgccggaggagtaccggctcggggccgcccccgaccggggcatcgagatc
cgcgggggcggtccggcgggcgtcttctggggcgcccagaccctgcgccagctgctcggt
cccgaggcgttccggcgcgcccccgtgcgccccgggggcacctacggcgtcccgcaccag
accgtgcgggacgctccccgcttcgcctggcgcggcctcatgctcgacgtcgcccgtcac
ttcctccccaaggaccaggtcctgcgctacgtggacctgatggccgcgcacaaactcaac
gtcctccacctccacctgacggacgaccagggctggcggatcgagatcgagcggtacccg
aggctgacggaggtcggctcctggcgggcgcgcacgagattcggccaccgcgcgtcaccg
ctctgggaggagaaaccgcacggcggccactacacgaaggacgacctccgcgagatcgtc
gcctacgcggccgcgcggcacatcaccgtggtgcccgagatcgacgtccccggacacagc
caggccgccatcgccgcgtatccggaactcggcaacaccgacgtcgtcgacacggccgcc
ctcaccgtctgggacacctggggcatcagcacgaacgtcctcgcccccaccgacggcacc
ctgcgcttctacgagggggtgttcgaggaggtcctggagctgttcccctcgcccttcgtg
cacatcggcggcgacgagtgccccaaggaccagtggcgcggttcggccaccgcgcaggcc
cgtgtccgggaactggggctcgcggacgaggacgccctgcagtcgtggttcgtccggcac
ttcgacaactggctgaccgcgcgcgggcgtcgcctgatcggatgggacgagatcctccag
ggcggcctcgcgccgggggcggccgtgtcgtcctggcggggctacgcgggcggcatcacg
gcggcccgcgccggccacgacgtggtgatgtgccccgagcagcaggtgtacctggaccac
cgtcaggacggcggccccgacgagccggtgcccatcggctgggtgcgcaccctggaggac
gtcttccggttcgagccggtgccaccggagttgacgcccgacgaggcccggcacgtgctc
ggcacccaggccaacgtgtggaccgaggcgatggaggacgccgcccgcgtggactaccag
accttcccgcgcctggcggccttcgccgaggtggcctggagccggctccccgcccccgcc
gagcgggacttcgccgatttcgagcgccggatggccgcgcactaccggcggctcgacgcc
ctgggggtcggttatcggccgccttcgggcccgcgcccgtggcagcggcggcccggcgtg
ctcggacgtccgatcgaggggaagcccccgaacgtgtga

DBGET integrated database retrieval system