KEGG   Streptomyces scabiei: SCAB_56461Help
Entry
SCAB_56461        CDS       T01187                                 

Definition
(GenBank) putative nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
scb  Streptomyces scabiei
Pathway
scb00760  Nicotinate and nicotinamide metabolism
scb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SCAB_56461
Enzymes [BR:scb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SCAB_56461
    3.5.1.-  
     SCAB_56461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase bPH_6 PLDc_2
Motif
Other DBs
NCBI-ProteinID: CBG72672
UniProt: C9Z162
Position
complement(6292927..6293514)
Genome map
AA seq 195 aa AA seqDB search
MRRALIVVDVQNDFCEGGSLAVAGGADVAAAVTELIGQAAGPGYQHVVATRDHHIAPGGH
FSDNPDYVHSWPAHCVAGTEGVGFHPNFAPVIASGAVDAVFDKGAYSAAYSGFEGADENG
VTLVDWLRAREITEVDVVGIATDHCVRATALDAAREGFRTQVLLDLTAGVSEETTERALE
ELREAGVELSGKPVV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgccttgatcgtcgtcgatgtacagaacgacttctgcgaggggggcagtctc
gcggtggccggtggtgccgatgtggccgccgccgtcaccgagctgatcggccaggcggcc
ggcccgggctaccagcacgtggtggccacccgtgaccaccacatcgcccccggtggccac
ttctccgacaaccccgactacgtccactcctggcccgcccactgtgtcgcggggaccgag
ggggtcgggttccacccgaacttcgccccggtgatcgcctccggcgcggtcgacgccgtc
ttcgacaagggggcgtactccgcggcgtacagcggcttcgagggcgccgacgagaacggc
gtcaccctcgtggactggctgcgcgcccgcgagatcaccgaggtcgacgtcgtcggcatc
gccacggaccactgcgtcagggccaccgccctggacgccgcccgggagggcttccgcacc
caggtgctgctggacctgaccgccggggtgtccgaggagacgacggagcgggccctggag
gagctgcgggaggcgggcgtggagctgtcgggcaagccggtggtctga

DBGET integrated database retrieval system