KEGG   Streptomyces scabiei: SCAB_57271Help
Entry
SCAB_57271        CDS       T01187                                 

Definition
O-glycosylhydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
scb  Streptomyces scabiei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6376549..6377589
Genome map
AA seq 346 aa AA seqDB search
MHPRGSWMYGRRGAGVRASVAVVAAISLAACSGGNDGDGGKNRSTGPGITQRPDGTDPFW
VNPRGNAAAQVAAYEKAGKDRDAELIRMIAEQPTGEWIGPENPEREARGFTEAAKEADRD
AVLVLYNIPHRDCGQYSGGGAADGDAYRAWIDGVARGIGDRAATVVLEPDAVLHVVDGCT
PEEFHGERYDLLKGAIERLGALKNTTVYLDAGNAGWGDPDEIYEPLKWAGIEQADGFAVN
VSNFYTTEDSIKYGKQLSSRIGDKPFVVDTSRNGNGPWNEGDEDERWCNPPGRALGETPT
TKTPDELVDAYLWVKRPGESDGECKGGPRAGEWWPEYALALAKASD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgcacccgagggggagttggatgtacggcaggaggggtgccggggttcgggcgtcggtg
gcggtggtggcggcgatatcgctcgccgcctgttccggggggaacgacggcgacggcggg
aagaaccggagcacagggccgggtatcacccaacggcccgacggcaccgacccgttctgg
gtcaatccgcgcgggaacgcggcggcacaggtcgccgcctacgagaaggccggcaaggac
agggacgccgagctgatccgcatgatcgccgagcagcccaccggcgagtggatcggcccg
gagaaccccgagcgggaggccaggggcttcaccgaggccgcgaaggaggcggaccgggac
gccgtcctcgtcctctacaacatcccgcaccgcgactgcggccagtactccggtggcggc
gcggccgacggcgacgcctaccgggcgtggatcgacggggtggcccggggcatcggggac
cgggcggccacggtcgtcctggagcccgacgcggtgctccacgtggtggacggctgcacc
ccggaggagttccacggggagcggtacgacctgctgaagggtgcgatcgagcggctcggt
gcgctgaagaacaccacggtgtacctggacgcgggcaacgccggctggggcgaccccgac
gagatctacgagcccctcaagtgggccgggatcgagcaggcggacggcttcgccgtcaac
gtctcgaacttctacaccaccgaggactccatcaagtacggcaagcagctctcgtccagg
atcggcgacaagccgttcgtggtcgacaccagccgcaacggcaacggcccctggaacgag
ggcgacgaggacgaacgctggtgcaacccgccgggacgggcgctgggggagacgcctacg
accaagactccggacgagctggtcgacgcgtacctgtgggtgaagcgtcccggggagtcc
gacggggagtgcaagggcggccccagggcgggggagtggtggccggagtacgccctggcc
ctggcgaaggcgtccgactga

DBGET integrated database retrieval system