KEGG   Streptomyces scabiei: SCAB_57691Help
Entry
SCAB_57691        CDS       T01187                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
scb  Streptomyces scabiei
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SCAB_57691
  Lipid metabolism
   00561 Glycerolipid metabolism
    SCAB_57691
   00600 Sphingolipid metabolism
    SCAB_57691
Enzymes [BR:scb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SCAB_57691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6422082..6423404
Genome map
AA seq 440 aa AA seqDB search
MHHPFTHVVSVPVDTRTARVHEEGWQSWSPSGAYALDAAPYRPTDGNRATVCYRPGATVP
AGTFQGEGLLALDPGDGTPVRLWAAPDPVHQVPSIRLTVADQVAEVTSDGPVKEWTGTDF
QAVLGEWAAGLGLPAPRPAPTVWCSWYEYFTSVTEDDIHENLRAMDTLDLPIDVVQIDDG
HQKALGDWLTLSGRFRSRAGIAGTIRARGRRAGIWTAPFLVDPSSTLAAEHPEWLVRDED
GGLTHAGHNWGHDLYALDSTHPGAAVYLTEVFTTLRAEGYDYFKTDFLYAGALDGVRHTG
VDALTAYRQGVELIRDAIGADAYLLGCGAPILPSLGLFDAMRVSPDTAPHRRPAADDFSQ
PGQDPAEFTGAGRQWQHGRLWVNDPDCLMARPAVETRERWAAHVEATGGLMASSDRLLSL
DTWGVDTTRRLLTKGAEATE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccaccccttcacccacgtggtctccgtgcccgtggacacccgtacggcacgcgtc
cacgaggagggctggcagtcctggagccccagtggcgcctacgccctcgacgcggccccg
taccgcccgaccgacggcaaccgggcgactgtctgctaccgcccgggggccaccgtcccg
gccggcaccttccagggggagggcctgctggccctcgacccgggcgacggcacaccggtc
cgcctctgggccgcacccgaccccgtccaccaggtcccctcgatccggctgacggtcgcg
gaccaggtcgccgaggtgacctccgacggcccggtgaaggagtggaccggcacggacttc
caggcggtgctgggcgagtgggcggcgggcctcggcctcccggccccccgcccggccccc
accgtctggtgctcctggtacgagtacttcacctccgtcaccgaggacgacatccacgag
aacctccgtgcgatggacaccctcgacctccccatcgacgtcgtacagatcgacgacggc
caccagaaggccctcggcgactggctcaccctctccggccgcttccgctcccgggcgggc
atcgccggcaccatccgggcccggggccgccgcgccggcatctggacggcgcccttcctc
gtcgacccgtcgagcaccctggccgccgaacaccccgagtggctggtgcgcgacgaggac
ggcggcctcacccacgccggccacaactggggccacgacctgtacgccctcgacagcacg
caccccggggcggcggtgtacctcaccgaggtcttcaccaccctgcgcgccgagggctac
gactacttcaagaccgacttcctctacgcgggcgcgctggacggcgtacggcacaccggt
gtggacgccctgacggcgtaccggcagggcgtcgaactgatccgtgacgcgatcggcgcc
gacgcctacctcctgggctgcggcgcgccgatcctcccgtccctgggcctcttcgacgcc
atgcgggtcagcccggacaccgccccgcaccgccgccccgcggcggacgacttcagccag
cccggccaggacccggccgagttcaccggcgccggccgccagtggcagcacggccgcctc
tgggtgaacgaccccgactgtctgatggcgcgccccgccgtcgagacacgcgaacgctgg
gcggcgcacgtcgaggcgaccgggggcctgatggcctccagcgaccgcctgctctcactg
gacacctggggcgtggacaccacacgccgactgctgacgaagggcgcggaggccaccgaa
tga

DBGET integrated database retrieval system