KEGG   Streptomyces scabiei: SCAB_57911Help
Entry
SCAB_57911        CDS       T01187                                 

Gene name
hexA
Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
scb  Streptomyces scabiei
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:scb00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:scb00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6444044..6445669
Genome map
AA seq 541 aa AA seqDB search
MEGALVSPRHRSTRLLGSLLLVATGMFAVGAAPVSHNTQAAATVPLGQVIPAPAAVRPAG
SPYRLTSAARIVVDGGPEVRRIGEYLAGILRPSTGYRLPVTDRREAGIRLRLAAGETGLG
QEGYRLESGPAGVTLTARAPAGLFHAVQTLRQLLPAAVERRSVQPGPWQVAGGTVEDTPR
YGWRGAMLDVSRHFFGVDQVKRYIDQLALYKFNKLHLHLSDDQGWRIAVDSWPRLASHGG
STQVGGGRGGFYTKADYREIVRYAASRHLEVVPEIDMPGHTNAALASYAELNCDGVAPPL
YTGTEVGFSSLCVGKDVTYDFVEDVVRELAALTPGRYLHIGGDEAHSTSHEDYATFMDRV
QPAVRKYGKTVIGWHQLTGATPAPGALAQYWGLDGTGAQEKERVAAAARNGTGIILSPAD
RIYLDMKYDKDTPLGLDWAGYVDVRRAYDWDPGAYLAGVPGAAVRGVEAPLWTETITSSA
DIEYLTFPRLPGVAELGWSPRSTHGWDGYRGRLAAQAPRWEALGVGYFRAPGVAWPPAVG
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
gtggagggagcactcgtgagtccgcgtcacagatcgacccgcctgctcggctcgctgctg
ctggtggcgaccgggatgttcgccgtgggagccgcacccgtgtcacacaacacccaggcc
gccgccaccgtcccgctcgggcaggtgatcccggcccccgccgcggtgcggcccgccgga
tcgccgtaccggctcacgagtgccgcgcgcatcgtcgtggacggcgggcccgaggtccgc
cggatcggggagtacctcgcggggatcctgcggccctcgacgggataccggctgccggtg
accgaccgccgggaggccggaatccgcctgcgcctggccgcaggggagacgggtctcggc
caggagggctaccggctggagagcggccccgcgggcgtgacgctcaccgcccgcgcgccc
gccggactcttccacgccgtgcagaccctgcgtcagctcctgcccgccgccgtcgagagg
cgatccgtgcagccggggccctggcaggtcgcgggcggcaccgtcgaggacaccccgcgc
tacggctggcgcggcgcgatgctggacgtctcccgccacttcttcggcgtggaccaggtg
aagcggtacatcgaccagctcgcgctctacaagttcaacaagctgcacctgcacctctcc
gacgaccagggctggcgcatcgcggtcgactcctggccgcgcctggcctcgcacggcggc
tccacgcaggtcggcggaggccggggcggcttctacaccaaggccgactaccgggagatc
gtccggtacgccgcctcccgccacctggaggtcgtccccgagatcgacatgcccggccac
accaacgccgccctcgcgtcctacgccgagctgaactgcgacggggtcgcgcccccgctc
tacaccggcaccgaggtcggcttcagctccctgtgcgtcggcaaggacgtgacgtacgac
ttcgtggaggacgtcgtacgggagctcgccgcgctcaccccgggccggtatctgcacatc
ggcggcgacgaggcgcactcgaccagtcacgaggactacgcgacgttcatggaccgggtg
cagccggcggtccgcaagtacggcaagacggtgatcgggtggcaccagctgaccggggcc
acgcccgcgccgggcgccctcgcgcagtactgggggctggacggcacgggtgcacaggag
aaggagcgggtggccgccgccgcgcggaacggcacgggaatcatcctgtcaccggccgac
cggatctacctcgacatgaagtacgacaaggacaccccgctggggctggactgggccggg
tacgtggacgtgcgacgcgcgtacgactgggacccgggagcgtatctggccggcgtgccg
ggggccgccgtgcggggggtcgaggcgccgttgtggacggagacgatcacttcctcggcg
gacatcgagtatttgacgttcccccggctgccgggggtcgcggagctgggttggtcgccg
aggtccacgcacgggtgggacgggtatcgggggcggcttgctgcgcaggctccgcggtgg
gaggcgctgggggtggggtatttccgtgcgccgggggtggcgtggcctccggcggtgggg
cggtag

DBGET integrated database retrieval system