KEGG   Streptomyces scabiei: SCAB_58101Help
Entry
SCAB_58101        CDS       T01187                                 

Gene name
gbh
Definition
guanidinobutyrase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
scb  Streptomyces scabiei
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SCAB_58101 (gbh)
Enzymes [BR:scb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SCAB_58101 (gbh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6466148..6467128
Genome map
AA seq 326 aa AA seqDB search
MSGNETPRGPVDSSRIPRYAGPATYARLPRLDEVGRADVAVVGVPFDSGVSYRPGARFGG
NAIREASRLLRPYNPAQDASPFALAQVADAGDIAANPFNIEEAVETVEAAADELLGTGAR
LMTLGGDHTIALPLLRSVAKKHGPVALLHFDAHLDTWDTYFGAAYTHGTPFRRAVEEGIL
DTEALSHVGTRGPLYGKQDLTDDAKMGFGIVTSADVMRRGPDEVADQLRQRIGDRPLYIS
IDIDCLDPAHAPGTGTPEAGGMTSRELLEILRGLASCHLVSADVVEVAPAYDHAEITAVA
ASHTAYELTTIMSRQIAEAREENTGR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaacgagacgccccgcggccccgtcgactcctcgcgcatcccgcgctacgcc
gggcccgccacctacgcccggctcccccgtctggacgaggtgggccgcgcggacgtggcg
gtcgtgggcgtgccgttcgactcgggcgtctcctaccggccgggcgcccgcttcggcggc
aacgcgatccgcgaggcgtcccggctgctgcgcccctacaacccggcccaggacgcctcc
cccttcgccctcgcccaggtcgcggacgccggtgacatcgccgccaaccccttcaacatc
gaggaggcggtggagacggtcgaggcggccgcggacgagctgctcgggacgggggcccgc
ctgatgaccctcggcggcgaccacaccatcgcgctcccgctgctgcggtcggtcgccaag
aagcacgggccggtggccctgctccacttcgacgcgcacctcgacacctgggacacgtac
ttcggcgccgcgtacacccacggcaccccgttccggcgcgcggtggaggagggcatcctc
gacaccgaggccctctcgcacgtgggcacgcgcggcccgctgtacggcaagcaggacctc
accgacgacgcgaagatgggcttcgggatcgtcacctcggcggacgtgatgcggcgcgga
cccgacgaggtcgccgaccagctgcggcagcgcatcggcgaccggcccctctacatctcc
atcgacatcgactgcctcgacccggcccacgctccgggcaccggcacgccggaggccggc
gggatgacctcgcgggaactcctggagatcctgcggggcctcgcctcctgccacctggtc
tccgccgacgtcgtcgaggtggcacccgcgtacgatcacgccgagatcaccgcggtggcc
gcctcgcacacggcctacgaactcaccacgatcatgtcccgccagatcgccgaggcccgc
gaggagaacacgggccggtga

DBGET integrated database retrieval system