KEGG   Streptomyces scabiei: SCAB_58701Help
Entry
SCAB_58701        CDS       T01187                                 

Definition
(GenBank) putative carbohydrate kinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
scb  Streptomyces scabiei
Pathway
scb00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCAB_58701
Enzymes [BR:scb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SCAB_58701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: CBG72889
UniProt: C9Z5Q8
Position
complement(6531881..6532780)
Genome map
AA seq 299 aa AA seqDB search
MYDYDLLVVGSANADLVIGVERRPGAGETVLGSDLAVHPGGKGANQAVAAARLGARTALL
ARVGDDGHGRLLLDSQRAAGVDTAGVLVGGAPTGVALITVDPSGDNSIVVSPGANGRLTP
EDVRAADALLRASRVVSAQLEIPLETVVEVVRRLPEGTRFVLNPSPPRELPAEVLAACDP
LIVNEHEARVIVGGELTGSPEEWARALLALGPRSVVVTLGAEGALVAGAGRSVRVAAVKV
DAVDTTGAGDAFTAALAWRLGAGAEPAEAAAYAARVGAVAVTRAGAQVSFPTAEEVEAL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactacgacctcctggtcgtgggatcggccaacgccgacctggtgatcggcgtc
gagcggcggccgggggccggggagaccgtgctcggttccgacctggccgtgcatccgggc
ggcaagggcgccaaccaggccgtcgcggcggcccggctcggggcgcgtacggcgctgctg
gcgcgggtcggcgacgacggccacgggcggctgctgctggactcgcagcgcgcggccggg
gtcgacacggcgggggtgctggtgggcggggcgcccaccggggtcgcgctgatcacggtg
gacccgtcgggcgacaacagcatcgtggtgtcgccgggcgccaacggaaggctgaccccc
gaggacgtacgggcggcggacgcgctgctgcgggcctcgcgggtggtctcggcgcagttg
gagatcccgttggagacggtggtggaggtcgtacggcggctgccggagggcacgcggttc
gtgctgaacccgtcgccgccccgggagttgcccgccgaggtgctggccgcctgtgatccg
ctgatcgtcaacgagcacgaggcgcgggtcatcgtcggcggtgagctgacgggttcgccg
gaggagtgggcgcgggcactgctggcgctcgggccgcgttcggtggtggtgacgctgggc
gcggagggggcgctcgtggccggcgccgggcggagcgtgcgggtggcggccgtgaaggtg
gacgccgtggacaccacgggggccggggacgcgttcacggcggcgctggcgtggcggctg
ggtgcgggcgcggagccggccgaggccgccgcgtacgcggcccgggtgggggccgtcgcc
gtcacccgggccggggcgcaggtgtcgttcccgacggcggaggaggtcgaggcgctctga

DBGET integrated database retrieval system