KEGG   Streptomyces scabiei: SCAB_58781Help
Entry
SCAB_58781        CDS       T01187                                 

Definition
DNA-binding protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
scb  Streptomyces scabiei
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:scb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SCAB_58781
Enzymes [BR:scb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SCAB_58781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6536994..6539255
Genome map
AA seq 753 aa AA seqDB search
MSKQAGNNEPTERRLAVLEGVLERITYANEDNGYTVARVDTGRGGGDLLTVVGALLGAQV
GESLRMEGRWGSHPQYGKQFTVENYTTVLPATVQGIRRYLGSGLVKGIGPVFADRITQHF
GLDTLQIIEEEPKRLIEVPGLGPKRTRKIADAWEEQKAIKEVMLFLQTVEVSTSIAVRIY
KKYGDASIGVVKNQPYRLAADVWGIGFLTADRIAQSVGIPHDSPERVKAGLQYALSQATD
QGNCYLPEERLIADAVKLLQVDTGLVIECLAELALPDEDSGEPGVVREKVPGQDGGDPVT
AIYLVPFHRAELSLSAQLLRLLRTDEDRMPGFHDVAWDKALAWLRGRTGAELAPEQEAAV
RLALTEKVAVLTGGPGCGKSFTVRSIVELARAKKAKVVLAAPTGRAAKRLAELTGADAST
VHRLLELKPGGDAAYDRDRPLDADLVVVDEASMLDLLLANKLVKAVAPGAHLLFVGDVDQ
LPSVGAGEVLRDLLADGGPIPAVRLTKVFRQAQQSGVVTNAHRINSGQHPVTDGMKDFFL
FVEDETEEAGRLTVDVAARRIPAKFGLDPRRDVQVLAPMHRGPAGAGTLNGLLQQAITPA
RPDLPEKRFGGRVFRVGDKVTQIRNNYDKGANGVFNGTVGVVTALDPVDQRLTVLTDEDE
EVEYEFDELDELAHAYAVTIHRSQGSEYPAVVIPVTTGAWMMLQRNLLYTAVTRAKKLVV
LVGSRKAIGQAVRTVSAGRRCTALDFRLAPRVF
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcaggcggggaacaacgagcccacggagcggcgtctcgccgttctcgaaggc
gtgctggaacgcatcacctacgccaacgaggacaacggctacaccgtcgcgcgcgtggac
accggccggggcggcggtgatctcctcaccgtcgtcggcgcgttgctcggggcccaggtg
ggggagtccctgcggatggagggccgctggggctcgcacccgcagtacggcaagcagttc
acggtggagaactacaccaccgtcctccccgccaccgtccagggcatccgccgctacctg
gggtccggcctggtcaagggcatcgggcccgtcttcgccgaccgcatcacgcagcacttc
ggcctggacaccctccagatcatcgaggaggagcccaagcgcctcatcgaggtccccggt
ctcggccccaagcgcaccaggaagatcgccgacgcctgggaggaacagaaggcgatcaag
gaggtcatgctcttcctccagaccgtcgaggtgtccacgtcgatcgccgtacgcatctac
aagaagtacggcgacgcctcgatcggggtggtgaagaaccagccgtaccggctcgccgcc
gacgtctggggcatcggcttcctcaccgccgaccggatcgcccagtccgtcggcattccc
cacgacagcccggagcgcgtcaaggcgggcctgcagtacgccctttcgcaggccaccgac
cagggcaactgctacctcccggaggagcgcctgatcgccgacgcggtcaagctcctccag
gtcgacacgggcctggtcatcgagtgcctggccgaactcgccctgcccgacgaggactcc
ggcgaacccggcgtcgtccgcgagaaggtgccgggccaggacggcggtgaccccgtcacc
gccatctacctcgtccccttccaccgcgccgaactctccctctccgcccagctgttgcgc
ctcctgcgcacggacgaggaccggatgcccggcttccacgacgtggcctgggacaaggcg
ctggcctggctgcggggacgtacgggtgcggagctggcccccgagcaggaggcggccgta
cggctcgcgctgaccgagaaggtggccgtgctcaccggcggccccggctgcggcaagtcc
ttcaccgtccgctcgatcgtggagctggcccgcgccaagaaggcgaaggtcgtgctggcc
gcccccaccggccgcgccgccaagcgccttgccgagctgaccggcgccgacgcctccacc
gtccaccgcctgctggagctgaagcccggcggcgacgcggcctacgaccgggaccgcccc
ctggacgccgacctcgtggtcgtcgacgaggcgtccatgctggacctcctgctggccaac
aagctggtgaaggcggtggcgccgggagcgcacctgctcttcgtcggggacgtcgaccag
ctcccgagcgtcggcgccggcgaggtcctcagggacctgctggccgacggcggcccgatc
ccggcggtccggctcaccaaggtcttccgtcaggcccagcagtccggcgtggtgaccaac
gcgcaccggatcaactccgggcagcacccggtcaccgacggcatgaaggacttcttcctc
ttcgtcgaggacgagacggaggaggcaggacggctcacggtcgacgtcgcggcccgtcgt
attccggccaagttcgggctcgacccgcgccgggacgtgcaggtcctggcgcccatgcac
cggggcccggcgggcgcgggcaccctcaacgggctgttgcagcaggccatcacccccgcc
cgccccgacctgcccgagaagcggttcggcggccgggtcttccgcgtcggcgacaaggtc
acccagatccgcaacaactacgacaagggcgcgaacggcgtcttcaacggcaccgtcggc
gtcgtcaccgccctcgaccccgtcgaccagcggctcaccgtcctcaccgacgaggacgag
gaggtggagtacgagttcgacgaactggacgagctggcgcacgcctacgcggtgaccatc
caccgctcccagggcagtgagtacccggccgtggtgatcccggtcaccaccggagcctgg
atgatgctccagcgcaacctgctctacacggcggtgacccgggcgaagaaactggtggtc
ctggtcggctcccgcaaggccatcggccaggcggtccgcacggtctccgccggccgccgg
tgcacggctctcgacttccggctcgcaccacgggttttttag

DBGET integrated database retrieval system