KEGG   Streptomyces scabiei: SCAB_58841Help
Entry
SCAB_58841        CDS       T01187                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
scb  Streptomyces scabiei
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SCAB_58841
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAB_58841
  Lipid metabolism
   00071 Fatty acid degradation
    SCAB_58841
  Amino acid metabolism
   00350 Tyrosine metabolism
    SCAB_58841
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCAB_58841
   00626 Naphthalene degradation
    SCAB_58841
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SCAB_58841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6547701..6548786
Genome map
AA seq 361 aa AA seqDB search
MFERFGEPATVQNLATPTPTPHGVVVRVEATGLCRSDWHGWQGHDPDITLPHVPGHELAG
IVEATGSAVTAWHPGDRVTVPFVCACGTCPTCAAGDQQVCERQTQPGFTHWGSFAQYVAL
DHADVNLVALPEELSYATAAALGCRFATAFRAVVAQGRVAPGEWVAVHGCGGVGLSAVMI
AAAAGARVVAVDVSPQALDLARTFGATACVNASTATTAPDPATPVPAAPGTTAPDTAAAV
RDLTGGGAHLSLDALGSPATCAASVNSLRRRGRHIQVGLLPSPEGTTPVPMARAVALELE
LLGSHGMAAHAYPRMLELVRAGVLRPDLLVTSTISLDAAPAALAAMGTAPGGGVTVIDPW
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgagcgtttcggagagccggccacggtacagaacctcgcgacccccacccccacc
ccccacggcgtagtcgtccgcgtcgaagccaccggcctctgccgcagcgactggcacgga
tggcagggccacgaccccgacatcaccctcccccacgtccccggccacgaactggccggc
atcgtggaggcgaccggcagcgcggtaaccgcctggcaccccggcgaccgcgtcaccgtc
ccgttcgtgtgtgcctgcggcacctgccccacctgcgccgccggagaccagcaggtgtgc
gagcgccagacccagccggggttcacccactggggatcgttcgcccagtacgtcgccctg
gaccacgccgacgtgaacctcgtggccctcccggaggaactctcgtacgccacggccgcc
gccctgggctgccgcttcgccacggcgttccgcgcggtcgtggcgcagggccgcgtcgcg
ccgggggagtgggtcgcggtccacggctgcggcggcgtgggcctgtcggccgtgatgatc
gcggcggccgccggagccagggtggtcgccgtggacgtctccccccaggcactggacctg
gcgcgcacgttcggcgcgacggcctgcgtgaacgcgtcaaccgcaacgaccgcacccgac
ccggccacccccgtcccggccgcacccggaacgaccgcacccgacaccgccgcggccgtc
cgagacctgaccggcggcggagcccacctctccctcgacgccctcggctccccggccacc
tgcgcggcctccgtcaacagcctccgccgccggggccgccacatccaggtgggcctgctc
ccgtcaccggagggcaccacccccgtgcccatggcccgggcggtggccctggaactggag
ctgctgggcagccacgggatggcggcccacgcctacccgaggatgctggagctggtccgc
gcgggcgtcctgcgccccgacctcctggtgacgtccacgatctccttggacgcggccccc
gccgccctcgcggcgatgggcacggccccgggcggcggagtgacggtcatcgacccgtgg
agctga

DBGET integrated database retrieval system