KEGG   Streptomyces scabiei: SCAB_59241Help
Entry
SCAB_59241        CDS       T01187                                 

Gene name
melC2
Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
scb  Streptomyces scabiei
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SCAB_59241 (melC2)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SCAB_59241 (melC2)
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     SCAB_59241 (melC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6588556..6589422
Genome map
AA seq 288 aa AA seqDB search
MAYTRKDVSTLTRTERRRFVNALLKLKQRGEYDEFVRMHIDHYVSDGDGGLRTAHMAPSF
LPWHRRFVLELEKALRRIDDSVTVPYWDWTRDRTTTSAPWTADLLGGNGRRSDLRVTTGP
FAYGTGRWTITEGLTDIEYLTRDFGYPRNPVALPTARDLDAALAESVYDKSPWNSVTRGG
FRNRLEGWGQGTGNGSWLNHNRVHRWVGGHMVGGASVNDPVFWLHHAFIDLQWTRWQQRH
RGARYLPAKPPGKGDAQRGRIVARDERMPPWNVTPGELESIGHVYRYG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcctacacccgtaaggacgtcagcacgctcacccgcacggagcgccggcggttcgtg
aacgccctgctcaagctcaaacagcgcggcgagtacgacgagttcgtgcggatgcacatc
gaccactacgtctccgacggcgacggcggtctgcggacggcccacatggcgccctccttc
ctgccctggcaccgccggttcgtgctggagctggagaaggcgctgcgccggatcgacgac
tcggtgaccgtgccgtactgggactggacacgggaccgtacgacgacgtccgcgccctgg
accgccgatctgctcggcggcaacgggcggcgctccgacctgcgggtgacgaccggcccg
ttcgcctacgggacgggccgatggaccatcacggaggggctcacggacatcgagtacctc
acccgggacttcggttacccgcgcaacccggtggccctgcccaccgcccgtgacctggac
gccgccctcgccgagtccgtctacgacaagtccccctggaactcggtcacccgcggaggc
ttccgcaaccggctcgaagggtggggccaggggaccgggaacggctcgtggctgaaccac
aaccgggtgcaccggtgggtcggcgggcacatggtcggcggggcctccgtcaacgacccc
gtgttctggctgcaccacgccttcatcgacctgcagtggacgcgctggcagcagcgccac
cgcggcgcccgctacctgccggccaagccgccgggcaaaggcgatgcccagcgggggcgg
atcgtcgcgcgcgacgagcggatgccgccctggaacgtgactccgggggagctggagtcg
atcgggcacgtgtaccggtacgggtga

DBGET integrated database retrieval system