KEGG   Streptomyces scabiei: SCAB_5931Help
Entry
SCAB_5931         CDS       T01187                                 

Definition
monooxygenase P450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
scb  Streptomyces scabiei
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SCAB_5931
  Amino acid metabolism
   00380 Tryptophan metabolism
    SCAB_5931
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SCAB_5931
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SCAB_5931
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SCAB_5931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(662435..665647)
Genome map
AA seq 1070 aa AA seqDB search
MTHATERGTESIPERSALPLVGHAFDIPGGADGLLHLMKEARELGPLFKLRVFGNEINIA
SGLDLVTELSDESRFRKNVHADLVLVREITGDGLFTAFNDEPNWRKAHDVLMPAFSLGAM
RGYHATMLKVARELIGKWDGAAGTEPVDVAEDMTRLTFDTIGLCGFGHDFESFGRPEPHP
FVTALSRALGFAQAKGESIPGLDLFKWKQAEQFRTDVAVMRDLVDDVIRERRASGDTGTD
DLLGRMLHTRDQVTGEPLDDVNIRHQAITFLIAGHETTSGALSFALYYLTKHPEVLARAQ
AEVDALWGDTDTPDPDYGDIGKLTYIRQVLNEGLRLWPTAPAYAVEPLEDTVIGGRYAVR
EGETIQVLIPQLHRDPAWGENVELFDPDRFLPEREQERPVHLFKPFGSGERACIGRQFAL
HEATLVLALVIHRYRLIDHTDYQLKIKQSLTIKPDEFTLRLARRTAGERRLPLVASDRAP
AGEAPPAVRRAAGTTLTLLHGSNLGTCAGIARELAEDGEQHGFAPTVASLDSAAGTLSAV
DGPVVIVAASYNGRPTDDATRFMEWLDDLAPGSLDGLRYAVLGVGDRNWAATYQRVPALI
DERLSAAGATALLERGAADASGDFAGTVDRWTGELWTTLLDRHGTAQDGVAAQPDTDAEG
GLYVLEDTTDSVIGGLAARHGVQPMEVLDARELVDMSHGLGRSKRFLRLRLPEGVTYRTG
DHLAVLPRNPDHLVRRVTDRFGLDPDRTVRLRARRRGRNTLPVDRPLTVRRLLTDFVELQ
DPATREQIAVLAEHTACPPEKRPLTELAAADPETFREQVTAAGRSVLDLLERHRACELPF
ERFLELLPVLRPRPYSISSSALAAPGEVDLMVSLLAAPHRAGEGMFHGIGSHFLQTVRPG
DTLQARVLPCSEAFRLPDDTSASVILVSAGTGLAPFRGAVLDRRHAGSTGTLLCYFGCDH
PDVDYLHRAEFEAAEAAGAVSMRPAFSCAPEDGVRFVQDRIGKESDEVWAALEAGARVHV
CGDGRRMAPAVREAFRALYRENTGADDAEATAWLDALTESGHYVEDVWAG
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgactcacgcgaccgaacgcggaaccgaatcgatccccgagcgttccgccctccccctg
gtcggccacgcgttcgacatacccggtggtgccgacggcctgctccatctgatgaaggag
gccagggaactcggtccgctgttcaagctgcgggtcttcggcaacgagatcaacatcgcc
tccggcctcgacctcgtcaccgagctgtcggacgagagccgcttccgcaagaacgtgcac
gcggacctcgtgctggtgcgggagatcaccggtgacggtctgttcacggcgttcaacgac
gagcccaactggcgcaaggcgcacgacgtcctcatgccggccttctccctcggcgcgatg
cgcggctaccacgccacgatgctcaaggtggcgcgtgagctgatcgggaagtgggacggg
gcggccgggaccgagcccgtggacgtcgccgaggacatgacccggctgaccttcgacacg
atcggactgtgcggcttcggccatgacttcgagtccttcggccgcccggaaccgcatccc
ttcgtgaccgcgctgtcgcgtgcgctcggcttcgcccaggccaagggagagtccatcccc
ggcctggacctgttcaagtggaagcaggccgaacagttccggaccgacgtcgccgtgatg
cgggacctcgtcgacgacgtgatccgggagcgcagggcctccggcgacaccggcacggac
gacctgctcggccgcatgctgcacacccgcgaccaggtcaccggcgaaccgctggacgac
gtcaacatccggcaccaggcgatcacgttcctcatcgccgggcacgagaccaccagcggg
gccctgtcgttcgccctgtactacctcaccaagcaccccgaggtcctcgcccgggcccag
gccgaggtcgacgctctgtggggcgacacggacacccccgaccccgactacggggacatc
gggaagctgacgtacatcaggcaggtgctcaacgagggcctgcggctctggccgacggct
cccgcctacgccgtggagcccctggaggacaccgtcatcggcggcaggtacgccgtgcgc
gagggcgagacgatccaggtgctgatcccgcagctgcaccgggaccccgcctggggcgag
aacgtcgagctgttcgaccccgaccgcttcctgcccgagcgggagcaggagcggccggtc
cacctgttcaaaccgttcggcagcggcgaacgcgcctgcatcggccgccagttcgcgctg
cacgaggccacgctcgtcctcgcgctggtgatccaccggtaccgcctgatcgaccacacc
gactaccagctgaagatcaagcagtcgctcacgatcaagcccgacgagttcaccctgcgc
ctggcccggcgcaccgccggggagcgacggctgccgctcgtcgcctcggaccgggccccg
gcgggggaggccccgcccgcggtccgcagggcggccggaaccacgctgaccctgctgcac
ggctccaacctgggcacctgcgcgggcatcgcgcgtgaactcgccgaggacggcgagcag
cacggcttcgcccccaccgtcgcctccctggacagcgccgcgggcaccctctccgccgtc
gacgggccggtggtgatcgtggccgcctcctacaacggcaggcccaccgacgacgccacg
cggttcatggagtggctcgacgacctggcacccggctccctcgacgggctccggtacgcc
gtcctcggcgtcggcgaccgcaactgggccgccacctaccagcgggttccggccctcatc
gacgagcggctgagcgcggccggcgccaccgcactgctggagcgcggcgccgcggacgcc
tccggcgacttcgccggcacggtggaccgctggaccggcgagctgtggaccaccctgctc
gaccgccacggaacagcccaggacggggtggcggcgcaaccggacacggacgcggagggc
ggactctacgtactggaggacaccaccgactcggtcatcggcggcctcgcggcacggcac
ggcgtccagcccatggaggtcctcgacgcccgcgaactggtcgacatgtcccacggtctc
ggccgctccaagcgtttcctcaggctgcggctgcccgagggggtcacctaccgcaccggc
gaccacctggccgtcctcccgcgcaacccggaccacctcgtccggcgggtcaccgaccgg
ttcggcctcgacccggaccgcaccgtccggctgcgcgcccgcaggcgcggccgcaacacc
ctccccgtcgaccgcccgctcaccgtccgacgtctcctcaccgacttcgtggaactccag
gaccccgccacgcgggagcagatcgccgtgctcgccgagcacaccgcctgcccgcccgag
aagcgccccctgacggaactcgccgcggccgaccccgagaccttccgcgagcaggtgacc
gccgccggacgcagcgtcctggacctgctggagcgtcatcgcgcctgcgagctgccgttc
gagcgcttcctcgaactgctccccgtcctgcgcccccgcccctactccatctcctcgtcc
gccctggcggcacccggcgaggtcgatctgatggtgtcgctcctcgccgccccccaccgg
gccggcgagggcatgttccacggcatcggctcgcacttcctgcagaccgtgcggccgggc
gacaccctgcaggcgcgggtcctgccctgcagcgaggcgttccgcctgcccgacgacacc
tccgcctccgtgatcctggtgagcgcgggcacgggactcgcgcccttccggggcgccgtc
ctcgaccgccgtcacgcgggctccaccgggacgctgctgtgctacttcggctgcgaccac
ccggacgtcgactacctgcaccgcgccgagttcgaggccgccgaggccgccggagccgtc
agcatgcggcccgccttctcctgcgctcccgaggacggggtccgcttcgtgcaggaccgg
atcggcaaggagagcgacgaggtctgggcggcgctggaggcgggcgcacgtgtccacgtc
tgcggcgacggccgccgtatggccccggcggtgcgcgaggcgttcagggccctctaccgc
gagaacaccggcgccgacgacgccgaggccaccgcatggctggacgccctgaccgaatcc
ggccactacgtcgaggacgtctgggccggctga

DBGET integrated database retrieval system