KEGG   Streptomyces scabiei: SCAB_59571Help
Entry
SCAB_59571        CDS       T01187                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
scb  Streptomyces scabiei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCAB_59571
Enzymes [BR:scb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SCAB_59571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6626648..6628720
Genome map
AA seq 690 aa AA seqDB search
MAETPLARLAALCGVATSYSPSPDRTVAASHGAVVAALAALDVDASTPESVAAALADRER
RLGERLLPPTVVRWADGELPAALTALPEGTRLRVETEEGELRSDVEDLPPGVHTLRATAP
DGRTADAHLVVAPARLPAPPGRTYGLLVQLYSLLSRRSWGMGDLGDLAELTSWAGRALGA
GFVQVNPLHAAVPGPPTDPSPYRPSSRRYPDPVHLRVEDVPEYPYVLASPEERDHVGALL
ERASLLRESVLVKGELIDRDAVWALKRTALERVCDVPLGPGRRAAYWDFLAEEGAALEDH
ATWCALAEVHGPEWQSWPAGLRDPRSAETARARGELMDRVDLHTRLAWLTDAQLGTAQRS
ARDAGMPIGLVHDLAVGVHPGGADAWAQQEYFASGMSVGAPPDAFNSRGQDWGLPPWRPD
RLAESGYAPYRHLLRALLRHAGALRIDHVMGLFRLWWVPQGQAPTEGTYVRYDADAMLAI
LVLEASRAGALVIGEDLGTVEPGVREALDARGVLGTSVLWFERDWEGTGRPLPPERWRAN
CLATATTHDLPPTASRLTCDHVELRHDLGLLTRSLEVERAEAAADAGEWLALLAELGMLD
GAGGGISTTSEEERIQAVHRFLLRTPARMVGLWLPDALGDRRPQNLPGTWDQYPNWRLPI
ADAGGRPAALEDLAASPRLYALVDVVRGLL
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaccccgctggcccggctcgccgccctgtgcggcgtcgccacctcctacagc
ccttccccggaccgtacggtcgcggcctcgcacggcgcggtcgtggccgctctcgccgcg
ctggacgtggacgcgagcaccccggagtccgtggccgccgccctcgcggaccgcgaacgg
cgactcggcgagcggctgttgccgccgaccgtcgtccgctgggccgacggggaactcccc
gccgcgctgaccgcactccccgagggcacccggctgcgcgtcgagaccgaggagggcgaa
ctccgctccgacgtcgaggacctccccccgggcgtccacaccctgcgcgccaccgccccc
gacgggcgcaccgccgacgcccacctggtggtggccccggcccggctgcccgccccgccc
ggccgcacgtacggccttctcgtccagctgtactccctcctgtcccgccgcagctggggc
atgggcgacctcggcgacctcgccgaactcacctcctgggccggccgcgccctcggcgcc
ggattcgtccaggtcaacccgttgcacgcggccgtccccggcccgcccaccgacccctcc
ccgtaccgcccctcctcccgccgctaccccgacccggtccacctgcgggtggaggacgta
cccgagtacccgtacgtcctcgcctcgcccgaggagcgcgaccacgtcggcgcgctgctg
gagcgggcctccctgctgcgggagtccgtcctggtgaagggcgagctgatcgaccgggac
gcggtgtgggccctcaagcgcacggcccttgaacgcgtgtgcgacgtgccgctcggtccc
ggccggcgggccgcctactgggacttcctcgccgaggagggcgcggcactggaggaccac
gccacctggtgcgcactcgccgaggtccacggccccgagtggcagagctggccggccggt
ctgcgcgacccgcgctccgccgagaccgcccgcgcccgcggggagctgatggaccgcgtc
gaccttcacactcgcctggcctggctgaccgacgcccagctcggtaccgcgcagcgctcc
gcgcgcgacgccggtatgccgatcgggctggtgcacgacctggccgtcggcgtgcacccc
ggcggcgccgacgcctgggcccagcaggagtacttcgcgtccggcatgtccgtcggcgcg
ccccccgacgccttcaactcccgcggccaggactgggggctgcccccctggcgcccggac
cgcctcgccgagtccggctacgcgccctaccgccacctcctgcgcgccctcctccgccac
gcgggcgccctgcgcatcgaccacgtcatgggcctgttccgcctctggtgggtcccgcag
ggccaggccccgaccgagggtacgtacgtccgctacgacgccgacgccatgctcgcgatc
ctggtcctggaggcgtcgcgggccggcgccctggtgatcggcgaggatctcggcacggtc
gagccgggggtgcgcgaggcgctcgacgcgcggggtgtgctgggcacgtccgtcctgtgg
ttcgagcgcgactgggagggcacgggccggcccctgccgcccgagcgctggcgggcgaac
tgtctcgccaccgccaccacgcacgacctcccgcccaccgcgtcccggctgacctgcgac
catgtcgagctgcggcacgacctggggctgctcacccggtccctggaggtggagcgggcc
gaggccgccgccgacgcgggcgaatggctggccctcctcgcggagctgggcatgctggac
ggtgccggcgggggcatctccaccacgtccgaggaggagcggatccaggccgtccaccgc
ttcctgctgcggacgcccgcgcgcatggtcggtctctggctgcccgacgcgctcggcgac
cgccgtccgcagaacctgcccggcacgtgggaccagtatccgaactggcggctgccgatc
gccgacgcggggggccgtccggcggccctggaggacctggcggcgtcgccccggctgtat
gcgctggtggatgtggtgcgggggctgttgtag

DBGET integrated database retrieval system