KEGG   Streptomyces scabiei: SCAB_6021Help
Entry
SCAB_6021         CDS       T01187                                 

Definition
glycosyl hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
scb  Streptomyces scabiei
Brite
Enzymes [BR:scb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SCAB_6021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
675581..676645
Genome map
AA seq 354 aa AA seqDB search
MMNQRKRLGRRRASVLGLAALLALATPGIANGAPQAGPGPAAGAPKAVKASTLGAQAAQS
GRYFGTAVAAGRLGDGQYTGILDREFNQVTAENEMKWDATERNRGQFTFGSADQIVNRAT
ARGQKVRGHTLVWHSQLPDWVKGIRDANTLRSVMNNHINTVAGRYKGRIHSWDVVNEAFA
DGGSGQMRGSVFRDVLGTGFIEEAFRTARAADPGAKLCYNDYNIEDWNAAKTQGVYRMVR
DFKSRGVPIDCVGLQSHFGAGGPPGSFQTTLSSFAALGVDVQITELDIAQAPANGYANTV
RACLNVARCTGITVWGIRDSDSWRSGENPLLFDRGGNKKPAYRSALTTMGGSLA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccagcggaaacggctcggccggcgccgggcgtcggtcctgggcctggcggcg
ctcttggccctcgccacgcccggcatcgcgaacggcgcaccgcaggccggtcccggcccg
gcggccggcgcgccgaaggcggtcaaggcgtccaccctgggcgcccaggccgcccagtcc
ggacggtacttcggcaccgccgtcgccgccggacggctcggtgacggccagtacaccggc
atcctggaccgcgagttcaaccaggtcaccgccgagaacgagatgaagtgggacgcgacc
gagcgcaaccgcggccagttcaccttcggctccgccgaccagatcgtgaaccgcgccacg
gcccggggccagaaggtccgcggccacacgctggtgtggcactcccaactgcccgactgg
gtcaagggcatcagggacgcgaacacgctgcgcagcgtgatgaacaaccacatcaatacc
gtggcgggccgctacaagggccgcatccactcctgggacgtggtcaacgaggccttcgcc
gacggcggcagcggccagatgcgcggctcggtcttccgggacgtgctcggcaccggcttc
atcgaggaggcgttccgcacggcccgcgcggccgacccaggggccaagctctgctacaac
gactacaacatcgaggactggaacgccgccaagacccagggtgtctaccgtatggtccgc
gacttcaagtcccggggtgtgcccatcgactgcgtcggactccagtcccacttcggtgcc
ggcggccctcccggcagcttccagacgacgctgtcgagcttcgccgctctcggggtggac
gtccagatcaccgagctggacatcgcccaggccccggcgaacgggtacgccaacacggtc
agggcctgtctgaacgtggcgcgctgcaccggcatcaccgtgtggggcatccgcgacagc
gactcctggcgcagcggcgagaacccgttgctcttcgaccggggcggcaacaagaagccc
gcgtaccggtcggcgctcaccacgatgggcggttcgctcgcgtga

DBGET integrated database retrieval system