KEGG   Streptomyces scabiei: SCAB_67491Help
Entry
SCAB_67491        CDS       T01187                                 

Definition
hypothetical protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
scb  Streptomyces scabiei
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SCAB_67491
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SCAB_67491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7470919..7472541
Genome map
AA seq 540 aa AA seqDB search
MQRQLTRRHILGMAALQTAAGLGLTRIGLQSARAAEPDAVDNAPALVIGSGYGAAVAALR
LGQAGIRTLVLEMGRAWTTPGADGKIFCSTKEPDERSMWFKTRTEAPLATFLWLDVVNQD
ISRYPGVLDRVRHANMSVFLGRGVGGGSLVNGSMAVTPLRSYFAEQFPTVDTAEMYSTYF
PRARSMLGVNTVDPAWFESTEWYRFSRVSRAHAAKAGLRTTFVPSVYDFDHMQREAAGTA
TKSALAGEVIYGNNHGKKSLDKTYLAAALGTGNVTIHTMERARGIRRLGDGTYVVTADRI
DGTGAVVETKEYGCTYLFLGAGSVGTTELLVRARAKGTLPALNASVGAGWGPNGNVMLGR
ANHLWDTVGANQSTMPVMGIDDWANTANPVFAEIAPLPTGLEHWVSLYLAITKNTERASF
TYDAATDSAKLGWSAAQSAVSSSMAKKLFDRINSANSTMYRYDLFGSSNKVFADDFTYHP
LGGCVLGRATDDYGRVKGYENLYVTDGSLVPGSIGVNPFVTITALAERNVARVLVEDTAP
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtcagctgacgagacgtcacatcctcggtatggccgctctccagaccgcggcc
ggcctcggtctcacccgcatcggcctccagtccgcccgggcggccgagcccgacgcggtc
gacaacgcccccgccctcgtcatcggctccggctacggtgccgccgtggccgccctccgc
ctcggccaggccggcatccgcaccctcgtcctggagatgggccgcgcctggaccaccccc
ggcgccgacggcaagatcttctgctcgacgaaggaacccgacgagcggtccatgtggttc
aagacccggaccgaggccccgctcgccaccttcctctggctggacgtcgtcaaccaggac
atcagccgctaccccggcgtcctggaccgtgtgcgccacgccaacatgtcggtcttcctg
ggccgcggtgtcggcggcggctccctggtcaacggcagcatggccgtcaccccgctccgg
tcgtacttcgccgagcagttcccgaccgtcgacaccgccgagatgtactccacctacttc
ccgcgcgcccgctccatgctcggcgtcaacaccgtcgaccccgcgtggttcgagtccacg
gagtggtaccgcttcagccgggtctcccgcgcccacgccgcgaaggcggggctcaggacc
accttcgtgccgagcgtctacgacttcgaccacatgcagcgcgaggccgccggcaccgcg
acgaagtcggccctcgcgggagaggtcatctacggcaacaaccacggcaagaagagcctc
gacaagacgtacctcgccgccgccctcggcaccggcaacgtcaccatccacaccatggaa
cgggcccggggcatccgccgcctcggcgacgggacgtacgtcgtcaccgccgaccggatc
gacggcaccggcgcggtcgtcgagaccaaggagtacggctgcacctacctgttcctcggc
gccggcagcgtcggcaccaccgaactcctcgtccgcgcccgggcgaagggcaccctgccc
gcgctgaacgccagtgtcggcgccggctgggggcccaacggcaacgtcatgctcggccgg
gccaaccacctgtgggacacggtcggggcgaaccagtcgaccatgccggtcatgggcatc
gacgactgggccaacaccgccaaccccgtcttcgcagagatcgccccgctgcccaccggc
ctcgaacactgggtgagcctctatctggcgatcaccaagaacaccgagcgcgcctccttc
acctacgacgccgcgaccgactcggcgaagctcggctggagcgccgcccagagcgcggtc
tcctcgtccatggccaagaagctcttcgaccggatcaactccgccaactccacgatgtac
cggtacgacctgttcggctcgtccaacaaggtgttcgccgacgacttcacctaccacccg
ctgggcggctgcgtgctgggcagggcgaccgacgactacgggagggtgaaggggtacgag
aacctgtacgtcaccgacggctcgctggtgcccggttcgatcggggtgaacccgttcgtc
acgatcaccgcgctcgcggaacgcaatgtggcgcgggtcctcgtggaggacaccgcgcca
tga

DBGET integrated database retrieval system