KEGG   Streptomyces scabiei: SCAB_67551Help
Entry
SCAB_67551        CDS       T01187                                 

Gene name
glkA
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
scb  Streptomyces scabiei
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAB_67551 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAB_67551 (glkA)
   00052 Galactose metabolism
    SCAB_67551 (glkA)
   00500 Starch and sucrose metabolism
    SCAB_67551 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    SCAB_67551 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCAB_67551 (glkA)
   00524 Butirosin and neomycin biosynthesis
    SCAB_67551 (glkA)
Enzymes [BR:scb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SCAB_67551 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7477976..7478929
Genome map
AA seq 317 aa AA seqDB search
MGLTIGVDIGGTKIAAGVVDEEGNILSTHKVPTPGTPEAIVDAIAAAVEGARAGHEIVGV
GIGAAGYVNRQRSMVYFAPNIDWRNEPLKEKVEARVGLPVVVENDANAAAWGEYKFGGGK
GHRNVICITLGTGLGGGIIIGNKLRRGHYGVAAEFGHIRMVPDGLMCGCGSQGCWEQYAS
GRALVRYAQQRANATPENAELLLGLGDGTPDGIEGKHISMAARQGDPVAVDSYRELARWA
GAGLADLASLFDPSAFIVGGGLSDEGELVLDPIRKSYKRWLVGGNWRPVAEVVAARLGND
AGLVGAADLAREPDPIM
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggactcaccatcggcgtcgacatcggcggtaccaagatcgcggctggtgtggtcgac
gaggaaggcaacatcctctcgacccacaaggtgccgaccccgggcacgcccgaggcgatc
gtggacgccatcgccgccgccgtcgagggcgcgcgagccggacacgagatcgtcggtgtc
ggcatcggcgctgccggttacgtcaaccggcagcggtcgatggtctacttcgcccccaac
atcgactggcgcaacgagccgctcaaggagaaggtcgaggcccgggtgggcctgccggtc
gtcgtggagaacgacgccaacgccgccgcgtggggcgagtacaagttcggcggcggcaag
ggccaccgcaacgtcatctgcatcaccctcggcaccggcctcggcggcggcatcatcatc
ggcaacaagctgcggcgcggtcactacggcgtcgccgccgagttcggccacatccggatg
gtccccgacgggctgatgtgcggctgcggctcccagggctgctgggagcagtacgcgtcc
gggcgggccctggtcaggtacgcccagcagcgcgccaacgccacccccgagaacgcggag
ctcctcctcggcctcggtgacggcacccccgacggcatcgagggcaagcacatctccatg
gccgcccgccagggcgaccccgtggccgtcgactcctaccgcgaactcgcgcgctgggcc
ggcgccggtctcgccgacctcgcctccctcttcgacccgtcggcgttcatcgtgggcggc
ggtctctcggacgagggcgaactggtcctggacccgatccgcaagtcctacaagcgctgg
ctcgtgggcggcaactggcgtccggtggccgaggtcgtcgccgcccggctcggcaacgac
gcgggcctggtgggcgcggcggacctggcgagagaacccgacccgatcatgtag

DBGET integrated database retrieval system