KEGG   Streptomyces scabiei: SCAB_67621Help
Entry
SCAB_67621        CDS       T01187                                 

Gene name
pfkA1
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
scb  Streptomyces scabiei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAB_67621 (pfkA1)
   01230 Biosynthesis of amino acids
    SCAB_67621 (pfkA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAB_67621 (pfkA1)
   00030 Pentose phosphate pathway
    SCAB_67621 (pfkA1)
   00051 Fructose and mannose metabolism
    SCAB_67621 (pfkA1)
   00052 Galactose metabolism
    SCAB_67621 (pfkA1)
  Energy metabolism
   00680 Methane metabolism
    SCAB_67621 (pfkA1)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SCAB_67621 (pfkA1)
Enzymes [BR:scb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SCAB_67621 (pfkA1)
Protein phosphatases and associated proteins [BR:scb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SCAB_67621 (pfkA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7484775..7485803
Genome map
AA seq 342 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRGAVRKGVQEYGYDFVGFRDGWRGPLENDTVRLDIPAVRGI
LPRGGTILGSSRTNPLNEENGIRRIKDNLAKQEVEALIAIGGEDTLGVAARLSDEYGVPC
VGVPKTIDNDLSATDYTFGFDTAVGIATEAIDRLHTTAESHMRVLVVEVMGRHAGWIAIH
SGLAGGANAILIPEQRFDVDKVCAWVTSRFKASYAPIVVVAEGAMPKDGEMVLKDGSLDS
FGHVRLSGVGEWLAKEIERRTGKEARTTVLGHVQRGGTPSAFDRWLATRFGLHAIDAVRD
RDFGKMVALRGTDIVRVPIADATAKLKTVDPKLYEEVGVFFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcggagtactcaccggaggcggcgactgccccgggctcaacgccgtcatccgg
ggcgccgtccgcaagggcgtgcaggagtacggctacgacttcgtgggcttccgggacggc
tggcggggtccgctggagaacgacaccgtccgcctcgacatccccgccgtccgcggcatc
ctgccccgcggcggcaccatcctcggctcctcgcgcaccaacccgctcaacgaggagaac
ggcatccgccgcatcaaggacaacctcgccaagcaggaggtcgaggcgctcatcgccatc
ggcggcgaggacacgctcggggtcgccgcgcggctgtccgacgagtacggggtgccgtgc
gtgggcgttccgaagacgatcgacaacgacctctccgccacggactacaccttcggcttc
gacacggccgtcggcatcgccacggaggccatcgaccgcctccacaccaccgccgagtcg
cacatgcgtgtgctggtggtcgaggtgatgggccggcacgccggctggatcgccatccac
tccggcctggccggcggcgccaacgccatcctcatccccgaacagcgcttcgacgtcgac
aaggtgtgcgcctgggtgacgtcgcgtttcaaggcctcctacgcgccgatcgtggtcgtc
gcggagggggccatgccgaaggacggggagatggtcctcaaggacggctcgctcgactcc
ttcggccatgtccggctctccggggtcggcgaatggctggccaaggagatcgagcggcgg
acgggcaaggaggcccggacgaccgtcctcggccacgtccagcgcggcggcaccccgtcc
gcgttcgaccgctggctcgccacgcgcttcgggctgcacgcgatcgacgcggtgcgcgac
cgggacttcggcaagatggtcgccctccggggcacggacatcgtccgcgtcccgatcgcc
gacgcgacggcgaagctgaagacggtcgacccgaagctgtacgaggaggtcggggtcttc
ttcggctga

DBGET integrated database retrieval system