KEGG   Streptomyces scabiei: SCAB_68351Help
Entry
SCAB_68351        CDS       T01187                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
scb  Streptomyces scabiei
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:scb01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:scb00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7569553..7570875
Genome map
AA seq 440 aa AA seqDB search
MISRIDLRGDALPEGPALRDLLPRADFDVSAALEKVRPICEAVHHRGDAALIDFAEKFDG
VRLTSVRVPAKALTEALEQLAPAVRAALEESIRRARIVHREQRRTTHTTQVVPGGTVTEK
WVPVERVGLYAPGGRSVYPSSVIMNVVPAQEAGVPSIALASPAQAEFDGLPHPTILAACA
LLGVDEVYAAGGATAVAMFAYGTESCPPANMVTGPGNIWVAAAKRYFTGVIGIDSEAGPT
EIAVLADDTADPVHVAADLISQAEHDPLAAAVLVTDSVALADAVEKELEPQVGATKHIED
RIRPALAGRQSAIVLVDGVDEGLRVVNAYGAEHLEIQTADAAAVAERVVNAGAIFIGPWA
PVSLGDYAAGSNHVLPTGGCACHSSGLSVQSFLRGIHIVDYTEDALAEVAHHVVTLAEAE
DLPAHGAAIKARFGWKVPGK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgatctcccgaatcgatctgcgcggcgacgccctcccggagggacccgccctgcgcgac
ctgctgccccgagccgacttcgacgtctcggccgccctggagaaggtgcgtccgatctgc
gaggccgtgcatcatcggggcgacgcggcgctgatcgacttcgccgagaagttcgacggg
gtgcgcctgacctccgtgcgggtcccggcgaaggctctcaccgaggccctggagcagctc
gccccggccgtccgcgcggccctggaggagtcgatccgccgcgcccgtatcgtccaccgt
gagcagcgccgcaccacgcacaccacccaggtcgtccccggcggcacggtcaccgagaag
tgggtaccggtcgagcgcgtcggtctctacgcccccggcggccgctcggtgtacccctcc
tccgtgatcatgaacgtggtcccggcgcaggaggccggcgtcccctcgatcgccctggcc
tccccggcgcaggccgagttcgacggactcccgcaccccacgatcctcgcggcctgcgcg
ctgctcggcgtcgacgaggtgtacgcggccggcggcgccaccgccgtggcgatgttcgcg
tacggcaccgagtcctgcccgcccgccaacatggtcaccgggccgggcaacatctgggtg
gcggccgccaagcggtacttcaccggtgtcatcggcatcgactccgaggcgggcccgacc
gagatcgccgtcctcgcggacgacaccgccgacccggtgcacgtcgccgccgacctgatc
agccaggccgagcacgacccgctggccgccgcggtgctcgtcaccgactccgtggccctc
gccgacgcggtcgagaaggagctggagccgcaggtcggcgccaccaagcacatcgaggac
cgcatccggcccgccctggccgggcggcagtccgcgatcgtcctggtcgacggcgtcgac
gagggcctgcgcgtcgtcaacgcctacggcgccgagcacctggagatccagaccgccgac
gccgcggccgtcgccgagcgcgtcgtcaacgccggcgcgatcttcatcggcccctgggcg
ccggtctccctgggcgactacgcggccggctccaaccacgtgctcccgaccggcggctgc
gcctgccactcctccggtctgtccgtccagtccttcctgcgcggcatccacatcgtcgac
tacaccgaggacgcgctggccgaggtcgcgcaccacgtggtgacgctggcggaggcggag
gacctgcccgcgcacggcgcggcgatcaaggcaaggttcggctggaaggtacccggcaag
tga

DBGET integrated database retrieval system