KEGG   Streptomyces scabiei: SCAB_68491Help
Entry
SCAB_68491        CDS       T01187                                 

Gene name
trpC1
Definition
indoleglycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
scb  Streptomyces scabiei
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCAB_68491 (trpC1)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCAB_68491 (trpC1)
Enzymes [BR:scb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SCAB_68491 (trpC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7580053..7580862
Genome map
AA seq 269 aa AA seqDB search
MSVLDEIIDGVRADLAERQARVSLDELKERAAKAPAAKDGAAALRGDGVKVICEVKRSSP
SKGALAAIADPAGLAADYEAGGAAIISVLTEQRRFGGSLADLEAVRARVDIPVLRKDFIV
TSYQLWEARAYGADVVLLIVAALDQPALESLIERAESIGLTPLVEVHDEDEVERAVDAGA
RVIGVNARNLKTLEVDRSTFERVAPEIPDSIVKIAESGVRGPHDLIAYANAGADAVLVGE
SLVTGKDPRTAVADLVAAGEHPALRHGRG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgctcgacgagatcatcgacggagtccgtgccgacctcgcggaacggcaggcg
cgcgtcagcctcgacgagctcaaggagcgcgcggcgaaggctccggcggccaaggacggc
gcggccgcgctccgcggcgacggcgtcaaggtgatctgcgaggtcaagcggtccagcccc
tccaagggcgcgctcgccgcgatcgccgacccggccggtctcgccgccgactacgaggcg
ggcggcgcggcgatcatctccgtcctcaccgaacagcgccgcttcggcggctcgctggcc
gacctggaggccgtccgggcgcgcgtggacatccccgtcctgcgcaaggacttcatcgtc
acctcgtaccagctgtgggaggcacgggcctacggcgccgacgtcgtcctgctcatcgtc
gccgcgctcgaccagccggcgctggaatcgctcatcgagcgcgcggagtccatcgggctc
accccgctcgtcgaggtccacgacgaggacgaggtcgagcgcgcggtcgacgccggagcg
cgggtgatcggcgtcaacgcccgcaacctcaagaccctggaggtcgaccgctccacgttc
gagcgggtcgcccccgagatcccggactccatcgtcaagatcgccgagtccggcgtccgg
ggcccgcacgacctcatcgcctacgccaacgccggcgccgacgccgtcctcgtgggcgag
tccctcgtcaccggcaaggaccccaggaccgccgtcgccgacctcgtcgccgcgggcgag
caccccgcgctgcggcacgggcggggctga

DBGET integrated database retrieval system