KEGG   Streptomyces scabiei: SCAB_68491Help
Entry
SCAB_68491        CDS       T01187                                 

Gene name
trpC1
Definition
indoleglycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
scb  Streptomyces scabiei
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:scb01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:scb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7580053..7580862
Genome map
AA seq 269 aa AA seqDB search
MSVLDEIIDGVRADLAERQARVSLDELKERAAKAPAAKDGAAALRGDGVKVICEVKRSSP
SKGALAAIADPAGLAADYEAGGAAIISVLTEQRRFGGSLADLEAVRARVDIPVLRKDFIV
TSYQLWEARAYGADVVLLIVAALDQPALESLIERAESIGLTPLVEVHDEDEVERAVDAGA
RVIGVNARNLKTLEVDRSTFERVAPEIPDSIVKIAESGVRGPHDLIAYANAGADAVLVGE
SLVTGKDPRTAVADLVAAGEHPALRHGRG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgctcgacgagatcatcgacggagtccgtgccgacctcgcggaacggcaggcg
cgcgtcagcctcgacgagctcaaggagcgcgcggcgaaggctccggcggccaaggacggc
gcggccgcgctccgcggcgacggcgtcaaggtgatctgcgaggtcaagcggtccagcccc
tccaagggcgcgctcgccgcgatcgccgacccggccggtctcgccgccgactacgaggcg
ggcggcgcggcgatcatctccgtcctcaccgaacagcgccgcttcggcggctcgctggcc
gacctggaggccgtccgggcgcgcgtggacatccccgtcctgcgcaaggacttcatcgtc
acctcgtaccagctgtgggaggcacgggcctacggcgccgacgtcgtcctgctcatcgtc
gccgcgctcgaccagccggcgctggaatcgctcatcgagcgcgcggagtccatcgggctc
accccgctcgtcgaggtccacgacgaggacgaggtcgagcgcgcggtcgacgccggagcg
cgggtgatcggcgtcaacgcccgcaacctcaagaccctggaggtcgaccgctccacgttc
gagcgggtcgcccccgagatcccggactccatcgtcaagatcgccgagtccggcgtccgg
ggcccgcacgacctcatcgcctacgccaacgccggcgccgacgccgtcctcgtgggcgag
tccctcgtcaccggcaaggaccccaggaccgccgtcgccgacctcgtcgccgcgggcgag
caccccgcgctgcggcacgggcggggctga

DBGET integrated database retrieval system