KEGG   Streptomyces scabiei: SCAB_68501Help
Entry
SCAB_68501        CDS       T01187                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
scb  Streptomyces scabiei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCAB_68501 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAB_68501 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCAB_68501 (trpB)
Enzymes [BR:scb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCAB_68501 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7581412..7582695
Genome map
AA seq 427 aa AA seqDB search
MSSEFFIPDPEGQVPSAEGYFGAFGGKFIPEALVAAVDEVAVEYDKAKHDPEFARELDDL
LVHYTGRPSALTEVPRFAEHAGGARVFLKREDLNHTGSHKINNVLGQALLTRRMGKTRVI
AETGAGQHGVATATACALFGLDCTIYMGEIDTQRQALNVARMRMLGAEVIAVKSGSRTLK
DAINEAFRDWVANVDRTHYLFGTVAGPHPFPAMVRDFHRVIGVEARRQILERAGRLPDAA
VACVGGGSNAIGLFHAFIPDASVRLIGCEPAGHGVETGEHAATLTAGEPGILHGSRSYVL
QDEEGQITEPYSISAGLDYPGIGPEHAYLKDSGRGEYRAVTDDAAMQALRLLSRTEGIIP
AIESAHALAGALEVGRELGKDGLIVVNLSGRGDKDMDTAARYFGLYDTDAEVAADAADLA
EIEGDAK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtgagttcttcattcccgaccccgagggtcaggttcccagcgccgaggggtat
ttcggcgcgttcggcggcaagttcatcccggaggcgctggtcgccgccgtggacgaggtc
gccgtggagtacgacaaggcgaagcacgaccccgagttcgcgcgtgagctcgacgatctg
ctcgtccactacaccggccggccgagcgcgctcaccgaggtgccccggttcgccgagcac
gccggcggggcgcgggtgttcctcaagcgcgaggacctgaaccacaccggatcacacaag
atcaacaacgtgctcgggcaggccctgctcacccggcgcatgggcaagacccgggtcatc
gccgagacgggagcgggccagcacggcgtcgccaccgccacggcctgcgcgctgttcggc
ctcgactgcaccatctacatgggcgagatcgacacgcagcggcaggccctgaacgtcgcc
cgcatgcgcatgctgggcgccgaggtcatcgcggtcaagtccggctcgcggaccctcaag
gacgccatcaacgaggcgttccgggactgggtcgccaacgtcgaccgcacgcactacctg
ttcgggaccgtggccgggccccaccccttccccgcgatggtccgcgacttccaccgggtc
atcggcgtcgaggcgcggcgccagatcctcgaacgcgccgggcggctgcccgacgcggcc
gtggcctgcgtgggcggcggttcgaacgccatcggcctcttccacgccttcatccccgac
gcctccgtacggctcatcggctgcgagcccgccggccacggcgtcgagaccggtgagcac
gcggcgacgctcaccgccggtgaaccgggcatcctgcacggctcgcgctcctacgtcctg
caggacgaggagggccagatcaccgagccgtactcgatctcggcgggcctggactacccg
ggcatcggccccgagcacgcgtacctcaaggacagcggccggggcgagtaccgcgccgtc
accgacgacgcggccatgcaggcactgcgtctgctgtcgcgcaccgagggcatcatcccg
gccatcgagagcgcccacgcgctcgccggcgccctggaggtcggcagggaactgggcaag
gacgggctgatcgtcgtcaacctgtccggtcgcggcgacaaggacatggacacggcggcg
cgctacttcggcctgtacgacaccgacgccgaggtcgcggccgacgcggccgatctcgcc
gagatcgagggggacgccaagtga

DBGET integrated database retrieval system