KEGG   Streptomyces scabiei: SCAB_68511Help
Entry
SCAB_68511        CDS       T01187                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
scb  Streptomyces scabiei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCAB_68511 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAB_68511 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCAB_68511 (trpA)
Enzymes [BR:scb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCAB_68511 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7582692..7583510
Genome map
AA seq 272 aa AA seqDB search
MSGNIQLLGDTLAAAKAEGRSALIAYLPAGFPTVDGGIAAIKAVFEGGADVVEVGLPHSD
PVLDGPVIQTADDIALRGGVKIADVMRTVREAFEATGKPVLVMTYWNPIDRYGVERFTAE
LAEAGGAGCILPDLPVQESALWREHAEKHGLGTVFVVAPSSRDARLAEITAAGSGFVYAA
SLMGVTGTRESVGAQAQDLVERTRATGSGLPVCVGLGVSNAEQAAEVAGFADGVIVGSAF
VKLMLDAPDEAAGLEAVRDLAGDLAKGVRRGV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcaacatccagctgttgggcgacaccctcgccgccgccaaggcggagggccgg
tccgcgctcatcgcctatctgccggccgggttcccgacggtcgacggcggcatcgccgcg
atcaaggcggtcttcgagggcggcgccgacgtcgtcgaggtcgggctgccgcacagcgac
cccgtcctcgacggacccgtcatccagaccgccgacgacatcgccctgcgcggcggtgtc
aagatcgcggacgtgatgcggacggtccgggaggcgttcgaggccaccggcaagcccgtc
ctcgtcatgacgtactggaaccccatcgaccgctacggcgtcgagcgtttcacggccgag
ctggccgaggcgggcggcgcgggctgcatcctgcccgacctgcccgtccaggagtcggcg
ctgtggagggagcacgccgagaagcacggcctcggcacggtcttcgtcgtcgcgcccagc
agcagggacgcccggctcgccgagatcaccgcggcgggcagcggcttcgtctacgccgcc
tcgctgatgggggtcaccggcacccgggagtcggtgggcgcgcaggcccaggacctggtg
gaacggacccgggccacgggctccggcctgccggtctgcgtcggtctcggcgtctccaac
gccgagcaggccgccgaggtcgccgggttcgccgacggcgtgatcgtcggctccgcgttc
gtgaagctgatgctggacgcccccgacgaggcggccggcctggaggccgtccgggacctc
gcgggagacctcgccaagggtgtgcgccggggcgtgtga

DBGET integrated database retrieval system