KEGG   Streptomyces scabiei: SCAB_68511Help
Entry
SCAB_68511        CDS       T01187                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
scb  Streptomyces scabiei
Pathway
scb00260  Glycine, serine and threonine metabolism
scb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01130  Biosynthesis of antibiotics
scb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAB_68511 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCAB_68511 (trpA)
Enzymes [BR:scb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCAB_68511 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB BtpA
Motif
Other DBs
NCBI-ProteinID: CBG73847
UniProt: C9YVH6
Position
7582692..7583510
Genome map
AA seq 272 aa AA seqDB search
MSGNIQLLGDTLAAAKAEGRSALIAYLPAGFPTVDGGIAAIKAVFEGGADVVEVGLPHSD
PVLDGPVIQTADDIALRGGVKIADVMRTVREAFEATGKPVLVMTYWNPIDRYGVERFTAE
LAEAGGAGCILPDLPVQESALWREHAEKHGLGTVFVVAPSSRDARLAEITAAGSGFVYAA
SLMGVTGTRESVGAQAQDLVERTRATGSGLPVCVGLGVSNAEQAAEVAGFADGVIVGSAF
VKLMLDAPDEAAGLEAVRDLAGDLAKGVRRGV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcaacatccagctgttgggcgacaccctcgccgccgccaaggcggagggccgg
tccgcgctcatcgcctatctgccggccgggttcccgacggtcgacggcggcatcgccgcg
atcaaggcggtcttcgagggcggcgccgacgtcgtcgaggtcgggctgccgcacagcgac
cccgtcctcgacggacccgtcatccagaccgccgacgacatcgccctgcgcggcggtgtc
aagatcgcggacgtgatgcggacggtccgggaggcgttcgaggccaccggcaagcccgtc
ctcgtcatgacgtactggaaccccatcgaccgctacggcgtcgagcgtttcacggccgag
ctggccgaggcgggcggcgcgggctgcatcctgcccgacctgcccgtccaggagtcggcg
ctgtggagggagcacgccgagaagcacggcctcggcacggtcttcgtcgtcgcgcccagc
agcagggacgcccggctcgccgagatcaccgcggcgggcagcggcttcgtctacgccgcc
tcgctgatgggggtcaccggcacccgggagtcggtgggcgcgcaggcccaggacctggtg
gaacggacccgggccacgggctccggcctgccggtctgcgtcggtctcggcgtctccaac
gccgagcaggccgccgaggtcgccgggttcgccgacggcgtgatcgtcggctccgcgttc
gtgaagctgatgctggacgcccccgacgaggcggccggcctggaggccgtccgggacctc
gcgggagacctcgccaagggtgtgcgccggggcgtgtga

DBGET integrated database retrieval system