KEGG   Streptomyces scabiei: SCAB_6911Help
Entry
SCAB_6911         CDS       T01187                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
scb  Streptomyces scabiei
Pathway
scb00790  Folate biosynthesis
scb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCAB_6911 (folP)
Enzymes [BR:scb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SCAB_6911 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: CBG67882
UniProt: C9YXA2
Position
complement(765453..766376)
Genome map
AA seq 307 aa AA seqDB search
MTVTIHAPATPAHPGTPDLHPHGLPRPGRTLVMGVVNVTPDSFSDGGLSFAADAAVAHGR
ALLEQGADLVDVGGESTRPGAARPPVEEELRRVLPVVRALAADGAVVSVDTMRAEVAARA
LEAGARLVNDVSGGLADPGMLPLMARAGVPYVLMHWRGHSAGMQANALYRDVVDEVLGEV
RLRIDAALEAGVPPGSLIVDPGLGFAKTPEHNWELLARLGEVRALGRPVLLGASRKAFLG
RLLADRTTGEPRPARERDAATAAVSVLAAAQGVWCLRVHDVVSTLDAVRVTARWGAEASV
AVRAPLR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtcacgatccacgcccccgccacgcccgcgcacccgggcacgccggacctgcac
ccgcacgggctgccgaggcccggccggacgctggtgatgggcgtcgtgaacgtcacgccg
gactcgttctccgacggcgggctgtcgttcgcggccgacgcggccgtggcccatggccgc
gccctgctggagcagggcgcggacctcgtggacgtgggcggcgagtcgacccgccccggc
gcggcgcgccctccggtcgaggaggagctgcgccgggtgctgcccgtcgtccgggccctc
gcggcggacggcgcggtcgtcagcgtcgacaccatgcgggccgaggtcgccgcacgcgcc
ctggaggcgggcgcgcggctggtcaacgacgtctcggggggcctcgccgatccggggatg
ctgcccctgatggcgcgggcgggggtgccgtacgtgctgatgcactggcgtggccactcc
gccgggatgcaggcgaacgccctctaccgcgacgtggtcgacgaagtgctcggcgaggtc
cggctgcggatcgacgcggccctggaggcgggcgtcccgcccggctcgctgatcgtcgat
cccgggctgggcttcgccaagacgcccgagcacaactgggaactgctggcccgtctcggg
gaggtccgcgcgctgggccgtcccgtcctgctgggtgcgtcccgcaaggcgttcctggga
cggctgctggccgaccggacgacgggggagccgcgcccggcgcgggagcgtgacgccgcg
accgccgccgtgtccgtgctcgccgccgcgcagggcgtctggtgtctgcgcgtgcacgac
gtcgtctcgacgctggacgcggtgcgggtgacggcccgctggggcgccgaggcgtcggtg
gcggtgcgggcgccgctgcgctga

DBGET integrated database retrieval system