KEGG   Streptomyces scabiei: SCAB_69721Help
Entry
SCAB_69721        CDS       T01187                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
scb  Streptomyces scabiei
Pathway
scb00010  Glycolysis / Gluconeogenesis
scb00051  Fructose and mannose metabolism
scb00562  Inositol phosphate metabolism
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01120  Microbial metabolism in diverse environments
scb01130  Biosynthesis of antibiotics
scb01200  Carbon metabolism
scb01230  Biosynthesis of amino acids
Module
scb_M00002  Glycolysis, core module involving three-carbon compounds
scb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAB_69721 (tpiA)
   00051 Fructose and mannose metabolism
    SCAB_69721 (tpiA)
   00562 Inositol phosphate metabolism
    SCAB_69721 (tpiA)
Enzymes [BR:scb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SCAB_69721 (tpiA)
Exosome [BR:scb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SCAB_69721 (tpiA)
  Exosomal proteins of bladder cancer cells
   SCAB_69721 (tpiA)
  Exosomal proteins of melanoma cells
   SCAB_69721 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-ProteinID: CBG73966
UniProt: C9YY64
Position
7726425..7727318
Genome map
AA seq 297 aa AA seqDB search
MSTRTPLMAGNWKMNLNHLEAIAHVQKLAFALADKDYEACEVAVLPPFTDLRSVQTLVDG
DKLKIKYGAQDLSAHDSGAYTGEISGPMLAKLKCTFVAIGHSERRQYHDETDEIVNAKVK
SAYKHGLTPILCVGEELEVREAGNHVSHTLAQVEGGLKDVSAEHAETVVVAYEPVWAIGT
GKVCGAEDAQEVCAAIRAKLAELYGQELADKVRIQYGGSVKAGNVAEIMAQADIDGALVG
ELYGQELADKVRIQYGGSVKAGNVAEIMAQADIDGALVGGASLDADEFVKIVRFRDQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcgtacgcccctgatggcgggcaactggaagatgaacctcaaccacctcgag
gccatcgcgcacgtccagaagctcgccttcgccctcgccgacaaggactacgaggcgtgt
gaggtcgcggtcctgccgcccttcaccgacctgcgctcggtccagaccctggtcgacggc
gacaagctcaagatcaagtacggcgcccaggacctctcggcccacgactccggcgcctac
accggcgagatctccgggccgatgctggccaagctcaagtgcacgttcgtggcgatcggc
cactcggagcgccgtcagtaccacgacgagaccgacgagatcgtcaacgccaaggtcaag
tccgcctacaagcacggcctgaccccgatcctgtgcgtcggcgaggagctggaggtccgc
gaggcgggcaaccacgtctcccacacgctcgcccaggtcgagggcggcctgaaggacgtc
tccgccgagcacgccgagaccgtcgtggtcgcctacgagcccgtctgggccatcggcacc
ggcaaggtctgcggcgccgaggacgcccaggaggtgtgcgcggccatccgcgccaagctc
gccgagctgtacggtcaggagctggccgacaaggtccgcatccagtacggcggctcggtc
aaggccggcaacgtcgccgagatcatggcccaggccgacatcgacggcgccctcgtcggc
gagctgtacggtcaggagctggccgacaaggtccgcatccagtacggcggctcggtcaag
gccggcaacgtcgccgagatcatggcccaggccgacatcgacggcgccctcgtcggcggt
gcctcgctggacgccgacgagttcgtcaagatcgtgcgcttccgcgaccagtga

DBGET integrated database retrieval system