KEGG   Streptomyces scabiei: SCAB_69721Help
Entry
SCAB_69721        CDS       T01187                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
scb  Streptomyces scabiei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAB_69721 (tpiA)
   01230 Biosynthesis of amino acids
    SCAB_69721 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAB_69721 (tpiA)
   00051 Fructose and mannose metabolism
    SCAB_69721 (tpiA)
   00562 Inositol phosphate metabolism
    SCAB_69721 (tpiA)
Enzymes [BR:scb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SCAB_69721 (tpiA)
Exosome [BR:scb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SCAB_69721 (tpiA)
  Exosomal proteins of bladder cancer cells
   SCAB_69721 (tpiA)
  Exosomal proteins of melanoma cells
   SCAB_69721 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7726425..7727318
Genome map
AA seq 297 aa AA seqDB search
MSTRTPLMAGNWKMNLNHLEAIAHVQKLAFALADKDYEACEVAVLPPFTDLRSVQTLVDG
DKLKIKYGAQDLSAHDSGAYTGEISGPMLAKLKCTFVAIGHSERRQYHDETDEIVNAKVK
SAYKHGLTPILCVGEELEVREAGNHVSHTLAQVEGGLKDVSAEHAETVVVAYEPVWAIGT
GKVCGAEDAQEVCAAIRAKLAELYGQELADKVRIQYGGSVKAGNVAEIMAQADIDGALVG
ELYGQELADKVRIQYGGSVKAGNVAEIMAQADIDGALVGGASLDADEFVKIVRFRDQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcgtacgcccctgatggcgggcaactggaagatgaacctcaaccacctcgag
gccatcgcgcacgtccagaagctcgccttcgccctcgccgacaaggactacgaggcgtgt
gaggtcgcggtcctgccgcccttcaccgacctgcgctcggtccagaccctggtcgacggc
gacaagctcaagatcaagtacggcgcccaggacctctcggcccacgactccggcgcctac
accggcgagatctccgggccgatgctggccaagctcaagtgcacgttcgtggcgatcggc
cactcggagcgccgtcagtaccacgacgagaccgacgagatcgtcaacgccaaggtcaag
tccgcctacaagcacggcctgaccccgatcctgtgcgtcggcgaggagctggaggtccgc
gaggcgggcaaccacgtctcccacacgctcgcccaggtcgagggcggcctgaaggacgtc
tccgccgagcacgccgagaccgtcgtggtcgcctacgagcccgtctgggccatcggcacc
ggcaaggtctgcggcgccgaggacgcccaggaggtgtgcgcggccatccgcgccaagctc
gccgagctgtacggtcaggagctggccgacaaggtccgcatccagtacggcggctcggtc
aaggccggcaacgtcgccgagatcatggcccaggccgacatcgacggcgccctcgtcggc
gagctgtacggtcaggagctggccgacaaggtccgcatccagtacggcggctcggtcaag
gccggcaacgtcgccgagatcatggcccaggccgacatcgacggcgccctcgtcggcggt
gcctcgctggacgccgacgagttcgtcaagatcgtgcgcttccgcgaccagtga

DBGET integrated database retrieval system