KEGG   Streptomyces scabiei: SCAB_70561Help
Entry
SCAB_70561        CDS       T01187                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
scb  Streptomyces scabiei
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCAB_70561
   00500 Starch and sucrose metabolism
    SCAB_70561
Enzymes [BR:scb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SCAB_70561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7815280..7816404
Genome map
AA seq 374 aa AA seqDB search
MTGRPPGPGRRSLLAAGAGSVLALAVAPRAEAARAGRRRVFGPYGSPAARLDERTLYVDA
AGAGDFTTVQAAVTAATGTGYTLVVAPGVYRETVAVGVARTGMTWIGASGDARDVVVMYD
NAAGTPKPGGGTYGTTGSATTLVQADGFTARDITFANDWLRADHPGITGTQAVALKVQGD
RSAFLRCRFLGHQDTLYADSTALGTFARQYFRDCYAEGDVDFVFGRATAVFERCRFRTLT
RTDLGSAPYGFVFAPSTAGANPRGYLVTRSRITSEAPDAFYKLARPWVPSSDTTARPMLT
VCRTRLDAGIDAVAPYTNMSSGFPWQEQRFAEYRNSGPGAAVTVPENRPQLTRAEAGAAT
REAYLGDWTPWEAF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggcgccccccgggcccgggcagacggtcattgctggccgccggggccgggagc
gtgctcgcgctcgccgtcgcgccccgggccgaggcggcccgggcgggccgccgccgcgtc
ttcgggccctacggatcaccggccgcccgcctcgacgagcggaccctgtacgtggacgcc
gccggcgccggcgacttcaccaccgtccaggccgccgtcaccgccgcgacgggcaccgga
tacaccctggtcgtcgcgcccggcgtgtaccgcgagaccgtcgccgtcggtgtcgcccgg
accgggatgacctggatcggggcctccggggacgcccgggacgtggtggtcatgtacgac
aacgcggccggtacgccgaagccgggcggcggcacctacggcaccaccgggtccgccacg
accctggtgcaggccgacgggttcaccgcgcgggacatcaccttcgccaacgactggctg
cgcgccgaccaccccgggatcaccggcacacaggccgtcgccctcaaggtgcagggcgac
cggtcggcgttcctgcggtgccgcttcctcggccaccaggacaccctgtacgccgactcg
acggccctcggcaccttcgcccggcagtacttccgcgactgctacgcggagggggacgtg
gacttcgtcttcgggcgggccacggccgtcttcgaacgctgccgcttccgtacgctgacc
aggaccgatctggggtccgccccgtacgggttcgtgttcgcgccctccacggcgggcgcc
aacccgcgcggttatctggtgacccgcagccggatcaccagcgaggccccggacgccttc
tacaagctggcccgcccctgggtgcccagctcggacaccaccgcccggcccatgctcacc
gtgtgccggacccgcctcgacgccggcatcgacgcggtcgcgccgtacacgaacatgtcg
tccggcttcccctggcaggagcagcggttcgccgagtaccggaacagcgggccgggcgcc
gccgtcaccgtccccgagaaccggccccagctcacccgcgcggaggccggggcggccacc
cgcgaggcgtacctcggcgactggaccccgtgggaggcgttctga

DBGET integrated database retrieval system