KEGG   Streptomyces scabiei: SCAB_70861Help
Entry
SCAB_70861        CDS       T01187                                 

Definition
chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
scb  Streptomyces scabiei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCAB_70861
Enzymes [BR:scb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SCAB_70861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7846129..7848183)
Genome map
AA seq 684 aa AA seqDB search
MSTHFPFTAVVGQGDLQLALLLNAIAPRIGGVLVRGEKGTAKSTAVRALAALLPPVEVVV
GCRFSCDPVEPDPACPDGPHEPAFETRPSRMVELPVGASEDRLVGALDIERALSEGVKAF
EPGLLADAHRGILYVDEVNLLHDHLVDLLLDAAAMGSSYVEREGVSVRHAARFLLVGTMN
PEEGELRPQLLDRFGLTVEVAASREPDQRVEVVRRRLAYDDDPAGFAARWAAEEAEVRQR
VVDARELLPSVVLGDGVLRQIAATCAAFEVDGMRADIVMARTATALAAWAGRTEVLAEDV
RQAALLALPHRRRRNPFDAPGLDEDRLDETLEEFAEPPRDPQEPQDPQDPQDPQDDDPDP
GPDGPGGGGQPPAPEPEGPQGGDGDARPESGEGVPAQAPAAGEQSAVRAAEPFRTKVLSV
PGLGEGAAGRRSRARTEHGRTTGARRPRGALTKLHLAATVQAAAPHQRTRGRSGPGLVVR
RDDLRQATREGREGNLVLFVVDASGSMAARQRMSAVKGAVLSLLLDAYQRRDKVGLVTFR
GASAEVALPPTSSVDAAAARLESLPTGGRTPLAAGLLKAHDVLRVERLRDPARRPLVVVV
TDGRATGGPEPVALAGRAARLFAAEGTASVVVDCESGHVRLGLAGRLAGELGGTAVTLDE
LRADSIAGLVRDVQGTQRTSGRAA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgcacttccccttcaccgccgtcgtcgggcagggcgacctgcaactcgccctg
ctcctcaacgcgatcgcgccgagaatcggcggcgtgctcgtgcgcggcgagaagggcacc
gccaagagcaccgcggtgcgggcgctcgcggcgctgctgccgccggtggaggtcgtcgtc
gggtgccggttctcctgcgaccccgtcgagccggacccggcgtgcccggacgggccgcac
gagccggcgttcgagacccggccctcccgcatggtcgagctgcccgtaggcgcctccgag
gaccgtctcgtcggcgccctcgacatcgaacgggccctgtcggaaggcgtcaaggcgttc
gagcccggtctgctggcggacgcccaccggggcatcctctacgtcgacgaggtcaacctg
ctccacgaccacctcgtcgacctgctgctcgacgcggccgcgatgggctcctcgtacgtg
gagcgcgagggcgtctccgtacggcatgccgcgcggttcctgctcgtcgggacgatgaac
cccgaggagggcgagctgcggccgcagttgctcgaccggttcgggctgaccgtggaggtc
gcggcctcgcgggagccggaccagcgggtggaggtcgtacggcgccggctcgcctacgac
gacgacccggcgggtttcgcggcccgttgggcggccgaggaggccgaggtacggcaacgg
gtcgtcgacgcaagggagttgctgccgtccgtggtgctgggcgacggggtgctgcggcag
atcgcggcgacctgcgcggccttcgaggtggacgggatgcgcgccgacatcgtgatggcc
cgtacggcgaccgcgctggccgcctgggccgggcggaccgaggtgctcgcggaggatgtg
cggcaggcggcgctgctggcgctgccgcaccggcggcggcggaacccgttcgacgcgccg
ggactcgacgaggacaggctcgacgagacgctggaggagttcgcggagccgccgcgcgac
ccgcaggaaccccaggacccccaggaccctcaggacccgcaggacgacgatcctgatccc
gggcccgacggccccggtggcggtgggcagccccccgctcccgagccggaggggccgcag
ggcggcgacggcgacgcccggcccgagtccggcgagggcgtgccggcgcaggctccggcc
gccggggagcagtccgccgtacgggccgccgagccgttccggacgaaggtgctcagtgtg
ccggggctcggggagggggccgccgggcggcgctcgcgggcccggaccgagcacgggcgc
accaccggggcgcgcaggccacgtggcgcgctgaccaagctgcatctggcggcgaccgtg
caggccgccgctccgcatcagcggacgcgcgggcgctccgggccgggcctggtggtccgg
cgcgacgatctgcggcaggcgacccgggaggggcgtgagggcaacctcgtgctgttcgtg
gtcgacgcctccgggtcgatggcggcccggcagcggatgagcgccgtgaagggcgcggtg
ctgtcgctgctcctcgacgcctaccagcggcgggacaaggtggggctggtgaccttccgg
ggcgcgtccgccgaggtggcgctgccgccgacctcgtccgtggacgcggcggcggcccgg
ctggagtcgctgccgacgggcgggcggacaccgctcgcggccggtctgctgaaggcgcac
gacgtgctgcgggtggagcggctgcgcgaccccgcgcgccggccgctggtcgtggtggtg
accgacgggcgggcgaccggcgggcccgagcccgtcgcgctcgccgggcgggcggcacgg
ctgttcgcggccgagggcaccgcgtccgtggtcgtcgactgcgagtctggccatgtccgg
ctgggtctcgccgggcggctggccggtgaactgggcggtacggcggtgacgttggacgag
ctgcgggcggactccatcgccgggctggtacgggatgtgcagggaacgcagaggacttca
gggagggcggcgtag

DBGET integrated database retrieval system