KEGG   Streptomyces scabiei: SCAB_70921Help
Entry
SCAB_70921        CDS       T01187                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
scb  Streptomyces scabiei
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SCAB_70921
Enzymes [BR:scb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SCAB_70921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7853120..7853878
Genome map
AA seq 252 aa AA seqDB search
MDEVNEADDDARDARGAGRREMPDEVARAWDELVATARRTVADGLVVGTSGNVSVRVGDT
LLVTPTGVPYDRLTPDDVTGVDLTGRQVLGTLRPTSELPMHLAIHTTAGARADTTAGARA
DTTAGARAVVHTHAVHATAVSTLVDELPLIHYMSAALGGPVRVAPYATYGTPELAENMLR
ALRGRTACLLRNHGTIAYGDSLDEAYDRTTQLEWMCQVWLKASSVPHLTPHLLTLGQLAE
TGERLKGYGQPG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtggacgaggtgaacgaggcggacgacgacgcgcgggacgcgcggggcgcggggcggcgg
gagatgccggacgaggtggcgcgggcgtgggacgaactcgtcgccaccgcccggcggacg
gtggccgacggtctggtcgtcggcacctccggcaacgtgtccgtgcgcgtgggggacacc
ctcctggtgacaccgaccggagtgccgtacgaccgcctgacgccggacgacgtcacgggc
gtcgacctcaccggccgacaggtcctcggcacgctccgccccaccagcgaactccccatg
cacctggcgatccacaccacggccggggcccgcgccgacaccacggccggggcccgcgcc
gacaccacggccggggcccgcgccgtcgtccacacccacgccgtgcacgcgacggccgtc
tccaccctcgtggacgagctgccgctgatccactacatgtccgcggcgctcggcggtccc
gtccgggtcgccccctacgcgacctacggcaccccggagctggccgagaacatgctccgc
gccctgaggggccgcaccgcctgcctcctccggaaccacggcacgatcgcctacggcgac
agcctcgacgaggcctacgaccgcacgacccagctcgaatggatgtgccaggtctggctg
aaggcgtcctccgtcccccacctcaccccgcatctgctcaccctcggacaactggccgag
acgggcgaacgcctcaagggctacgggcagccgggctga

DBGET integrated database retrieval system