KEGG   Streptomyces scabiei: SCAB_72711Help
Entry
SCAB_72711        CDS       T01187                                 

Gene name
xlnB
Definition
endo-1,4-beta-xylanase B
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
scb  Streptomyces scabiei
Brite
Enzymes [BR:scb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SCAB_72711 (xlnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8041916..8042614
Genome map
AA seq 232 aa AA seqDB search
MNDASAPTPTPPPSRRLFLGGLCTTALAAATTVALPGTAHADTVITSNRTGTDNGFYYSF
WTDAPGTVSMTLASGGAYRTSWSNTGNFVAGKGWSNGSRRTVSYSGSFNPSGNAYLTLYG
WTANPLVEYYIVDNWGNYRPTGTYRGTVNSDGGTYDIYRTTRYNAPSVEGVRTFDQYWSV
RQSRRTGGTITTGNHFDAWGRAGMPLGAFRYYMIMATEGYRSSGNSSITVAP
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgcatccgcacccactcccaccccgcccccgagccgccggctcttcctgggc
ggactctgcacgaccgcgctggccgccgcgaccacggtggccctgcccggcaccgcccac
gcggacacggtcatcaccagcaaccggaccggcaccgacaacgggttctactactccttc
tggaccgacgcccccggcacggtctccatgaccctggcctccggcggcgcctaccggacc
tcctggagcaacaccggcaacttcgtcgcgggcaagggctggagcaacggctcccgcagg
accgtgagctactccggctcgttcaatccgtccggcaacgcctatctgaccctctacggc
tggacggccaacccgctcgtcgagtactacatcgtcgacaactggggcaactaccggccc
accggaacctaccggggcacggtcaacagcgacggcggcacgtacgacatctaccggacg
acgcggtacaacgctccctccgtcgagggggtccgcaccttcgaccagtactggagcgtc
cgtcagtcgcgccggacgggcgggaccatcaccaccggcaaccacttcgacgcctggggc
cgtgcgggcatgcccctcggcgccttccgctactacatgatcatggccaccgaggggtac
cggagcagcggcaactcctcgatcacggtggccccgtga

DBGET integrated database retrieval system