KEGG   Streptomyces scabiei: SCAB_74881Help
Entry
SCAB_74881        CDS       T01187                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
scb  Streptomyces scabiei
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:scb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8280261..8280866
Genome map
AA seq 201 aa AA seqDB search
MIAFVSGPVAALAPDSAVVEVGGIGIAVQCTPNTLSGLRRGQQAKLATSLVVREDSLTLY
GFVDDDERQVFELLQTASGVGPRLAQAMLAVHTPDALRRAVATADEKALIAVPGIGKRGA
QKLLLELKDRLGEPVGAPAVGTPVTQGWRDQLHAALIGLGYATREADEAVAAVAPQAEAA
PGTPQVGQLLKAALQTLNRTR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccttcgtctccggcccggtcgccgccctcgcccccgactccgcggtggtcgag
gtgggcgggatcggcatcgcggtccagtgcacgcccaacactctctccgggctgcgcagg
ggacagcaggccaagctggccacgtccctggtggtccgtgaggactcgctcaccctctac
ggcttcgtggacgacgacgagcgccaggtcttcgaactgctgcagaccgcgagcggggtc
ggaccccgcttggcccaggcgatgctggcggtgcacaccccggacgcgctccgccgggcg
gtggccactgctgacgagaaggcactgatcgccgttcccggcatcggcaagaggggcgcc
cagaagctgctgctggaactgaaggaccgcctcggtgagcccgtgggcgctcccgcggtc
ggcaccccggtcacccaggggtggcgcgaccagctgcacgccgccctgatcggcctcggc
tacgccacccgcgaggccgacgaggccgtggcggccgtggccccccaggcggaggccgcc
ccgggcacgccccaggtcgggcagctgctgaaggccgccctccagaccctcaacagaacg
cgctga

DBGET integrated database retrieval system