KEGG   Streptomyces scabiei: SCAB_75271Help
Entry
SCAB_75271        CDS       T01187                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
scb  Streptomyces scabiei
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:scb00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8322703..8323296
Genome map
AA seq 197 aa AA seqDB search
MAATFRGTTPEPPDVRPRLTVLSGPSGVGKSTVVAHMRKAHPEVWLSVSATTRKPRPGER
NGVHYFFVTDEEMDKLIANGELLEWAEFAGNRYGTPRAAVLERLEKGEPVLLEIDLQGAR
QVRETMPDAQLVFLAPPSWDELVRRLTGRGTEPPEVIERRLEAAKIELAAEPEFDVTLVN
TSVEDVARELLALVDVV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaacattccgggggacgacccccgagcccccggacgtacgtccgcggctgacc
gtgctctccggcccctccggggtcggcaagagcacggtcgtcgcccatatgcgcaaggcg
caccccgaggtctggctctcggtgtcggcgacgacccgcaagccgcgccccggtgagcgg
aacggagtccactacttcttcgtcaccgacgaggagatggacaagctgatcgccaacggc
gagctgctggagtgggccgagttcgccggcaaccgctacggcactccccgggccgccgtg
ctcgaacgcctggagaagggtgagccggttctgctggagatcgacctccagggcgcacgg
caggtccgcgagaccatgccggacgcccagctggtcttcctggcgcctccctcctgggac
gagctggtgcgccggctcaccgggcggggcaccgaaccgcccgaggtgatcgaacgccgc
ctggaggcggccaagatcgagctggcggccgagccggagttcgacgtcaccctggtcaac
acctccgtcgaggacgtggctcgcgagctgctagccttggtggatgttgtgtga

DBGET integrated database retrieval system