KEGG   Streptomyces scabiei: SCAB_75271Help
Entry
SCAB_75271        CDS       T01187                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
scb  Streptomyces scabiei
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCAB_75271
Enzymes [BR:scb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SCAB_75271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8322703..8323296
Genome map
AA seq 197 aa AA seqDB search
MAATFRGTTPEPPDVRPRLTVLSGPSGVGKSTVVAHMRKAHPEVWLSVSATTRKPRPGER
NGVHYFFVTDEEMDKLIANGELLEWAEFAGNRYGTPRAAVLERLEKGEPVLLEIDLQGAR
QVRETMPDAQLVFLAPPSWDELVRRLTGRGTEPPEVIERRLEAAKIELAAEPEFDVTLVN
TSVEDVARELLALVDVV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaacattccgggggacgacccccgagcccccggacgtacgtccgcggctgacc
gtgctctccggcccctccggggtcggcaagagcacggtcgtcgcccatatgcgcaaggcg
caccccgaggtctggctctcggtgtcggcgacgacccgcaagccgcgccccggtgagcgg
aacggagtccactacttcttcgtcaccgacgaggagatggacaagctgatcgccaacggc
gagctgctggagtgggccgagttcgccggcaaccgctacggcactccccgggccgccgtg
ctcgaacgcctggagaagggtgagccggttctgctggagatcgacctccagggcgcacgg
caggtccgcgagaccatgccggacgcccagctggtcttcctggcgcctccctcctgggac
gagctggtgcgccggctcaccgggcggggcaccgaaccgcccgaggtgatcgaacgccgc
ctggaggcggccaagatcgagctggcggccgagccggagttcgacgtcaccctggtcaac
acctccgtcgaggacgtggctcgcgagctgctagccttggtggatgttgtgtga

DBGET integrated database retrieval system