KEGG   Streptomyces scabiei: SCAB_78581Help
Entry
SCAB_78581        CDS       T01187                                 

Gene name
pfkA3
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
scb  Streptomyces scabiei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAB_78581 (pfkA3)
   01230 Biosynthesis of amino acids
    SCAB_78581 (pfkA3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAB_78581 (pfkA3)
   00030 Pentose phosphate pathway
    SCAB_78581 (pfkA3)
   00051 Fructose and mannose metabolism
    SCAB_78581 (pfkA3)
   00052 Galactose metabolism
    SCAB_78581 (pfkA3)
  Energy metabolism
   00680 Methane metabolism
    SCAB_78581 (pfkA3)
Enzymes [BR:scb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SCAB_78581 (pfkA3)
Protein phosphatases and associated proteins [BR:scb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SCAB_78581 (pfkA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8679828..8680853)
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSVVHRAVVDHGDEVIGFRDGWKGLLECDYLKLDLDAVAGI
LARGGTILGSSRVQPSHLRDGVARAKSHVEELGLDAIIPIGGEGTLKAARLMSDNGLPVV
GVPKTIDNDIAVTDVTFGFDTAVGVATEALDRLKTTAESHQRVLVVEVMGRHTGWIALHS
GMAAGAHAIVVPERPFDIEELTAKVAERFSAGKRFAIVVAAEGAKPKAGSMDFDEGGKDI
YGHERFAGIARQLSVELEQRLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAVHR
GEFGNMTALRGTDIAMVPLAEAVETLKTVPDERYAEAECVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattggtgtcctcacgtccggcggcgactgtcccggactgaacgccgtcatcagg
tccgtcgtgcaccgcgccgtcgtcgaccacggcgacgaggtcatcggcttccgggacggc
tggaagggtctgctggagtgcgactacctcaagctggacctggacgcggtggccggcatc
ctggcccgcggcggcacgatcctcggctcctcccgggtccagccctcgcatctgcgggac
ggggtggcgcgggccaagagtcatgtcgaggaactcggtctggacgcgatcatccccatc
ggcggtgagggcacgctgaaggcggcccggctgatgtcggacaacggcctgcccgtcgtg
ggcgtgccgaagaccatcgacaacgacatcgcggtcacggacgtcaccttcggcttcgac
acggccgtgggcgtcgccacggaggccctggaccggctgaagaccaccgccgagtcccac
cagcgggtcctggtcgtggaggtcatgggccgccacaccggctggatcgcgctgcactcc
ggcatggcggccggcgcgcacgccatcgtcgtccccgagcggcccttcgacatcgaggag
ctgaccgcgaaggtcgccgagcggttctcggcgggcaagcggttcgcgatcgtcgtcgcg
gcggagggcgccaagccgaaggccgggtccatggatttcgacgagggcggcaaggacatc
tacgggcacgagcgcttcgccgggatcgcccgccagctctcggtcgagctggagcagcgc
ctcggcaaggaggcgcggccggtgatcctcggccatgtgcagcggggcggtaccccgacc
gcgtacgaccgggtgctggcgacgcggttcggctggcacgcggtggaggccgtgcaccgg
ggcgagttcgggaacatgaccgcgttgcggggcaccgacatcgcgatggtgccgctcgcc
gaggccgtggagacgctgaagaccgtgccggacgagcggtacgccgaggcggagtgcgtg
ctctag

DBGET integrated database retrieval system