KEGG   Streptomyces scabiei: SCAB_82741Help
Entry
SCAB_82741        CDS       T01187                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
scb  Streptomyces scabiei
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAB_82741
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAB_82741
   00052 Galactose metabolism
    SCAB_82741
   00500 Starch and sucrose metabolism
    SCAB_82741
   00520 Amino sugar and nucleotide sugar metabolism
    SCAB_82741
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCAB_82741
   00524 Butirosin and neomycin biosynthesis
    SCAB_82741
Enzymes [BR:scb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SCAB_82741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9175763..9176803
Genome map
AA seq 346 aa AA seqDB search
MLPDFRPEIRAPLCRAPGGRLAAGELTLMQTDLVAALDIGGTKIAGALVDGHGRIVVRAQ
RPTPAREDGDTVMRAVEGVLGELRGAPQWGGVTALGIGSAGPVDASAGTVSPVNIHGWRG
FPLVDRVRAATGGLPVELIGDGVAITAAEHWQGAARGHDNALCMVVSTGVGGGLVLGGRL
HAGPTGNAGHIGHISVDLDGEACPCGSHGCVERIASGPNIARRALERGWRPGPDGDTSAA
AVAAAARAGDPVAVASFERAARALAAGIAATATLVEIDIAVIGGGVANAGDVLLAPLRAA
LKDYATLSFVQHLTVAPAVMGTDAGLVGAAAAALTGRPGAGAGLAG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgctgccggatttccggccggagatccgggcgccgctctgccgggcgcccggcgggaga
ctcgcagcgggagaactgacactgatgcagaccgacctcgtggccgcgctcgacatcggc
ggcaccaagatcgccggggcgctggtggacggccacggccggatagtggtccgcgcccag
cgaccgacgcccgcacgggaggacggcgacaccgtcatgcgggccgtcgagggtgtgctc
ggcgagctgaggggcgcgccgcagtggggtggcgtgacggccctcgggatcggcagcgcg
gggccggtggacgcctcggccggcacggtgagccccgtgaacatccacggctggcgcggc
ttcccgctcgtcgaccgggtccgggcggcgaccggcggactgcccgtggagctgatcggc
gacggtgtcgccatcacggcggccgagcactggcagggcgcggcacgcggccacgacaac
gcgctctgcatggtcgtgtcgaccggtgtcggcggcggcctggtcctcggcggccgactg
cacgccggtcccaccggcaacgccggtcacatcgggcacatcagcgtggacctcgacggc
gaggcctgcccgtgcggctcccacggctgcgtcgagcgcatcgcgagcgggcccaacatc
gcccgccgtgccctggagcgcggctggcggcccggtcccgacggggacacctcggccgcc
gcggtggccgccgccgcgcgggcgggcgacccggtcgcggtggcgtccttcgagcgcgcc
gcacgggccctcgccgcgggaatcgccgccaccgccaccctcgtcgagatcgacatcgcg
gtcatcggcggcggcgtcgcgaacgccggcgacgtcctcctcgcccctctccgcgccgcc
ctgaaggactacgccaccctctccttcgtccagcacctcaccgtcgcccccgcggtgatg
ggcacggacgcgggcctcgtcggagccgccgcggcggcactgacggggcgtccgggcgcg
ggggcgggcctggcgggatag

DBGET integrated database retrieval system