KEGG   Streptomyces scabiei: SCAB_83591Help
Entry
SCAB_83591        CDS       T01187                                 

Definition
(GenBank) putative glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
scb  Streptomyces scabiei
Pathway
scb00220  Arginine biosynthesis
scb00250  Alanine, aspartate and glutamate metabolism
scb00471  D-Glutamine and D-glutamate metabolism
scb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCAB_83591
   00220 Arginine biosynthesis
    SCAB_83591
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SCAB_83591
Enzymes [BR:scb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SCAB_83591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CBG75311
UniProt: C9YYF3
Position
9278899..9279819
Genome map
AA seq 306 aa AA seqDB search
MGSPTYQAVLERIAEEIERTPGRGRPADYIPALAAVDPRRFGMAVAEPDGTVYGVGDWRE
PFSTQSITKVFTLALDLAREGDALWEHVGREPSGNPFNSLVQLEYESGIPRNPFINAGAL
VVTDRLHTRTGDAAGELLAFLRSESGNPDLDFDVEIAASETAHGDRNAALAHFMASYGNI
DNPVPALLDQYFRQCSLTASCADLALATTFLARHGVRADGTRLLTRSQAKQVNAVMLTCG
TYDAAGEFAYRVGLPGKSGVGGGIIAVVPGRCGLCVWSPGLDERGNSVAGVAALDRFTTL
TGLSVF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgcccacctaccaggcggtgctggaacgcatcgccgaggagatcgagcggacc
ccgggccgcggccggcccgccgactacatcccggcgctcgcggccgtcgacccgcgccgc
ttcggcatggccgtcgcggaaccggacggcacggtgtacggcgtgggggactggcgcgag
ccgttctccacgcagtccatcaccaaggtgttcaccctcgccctcgacctggctcgcgag
ggtgacgccctctgggagcacgtgggccgggagccctcaggcaaccccttcaactccctg
gtccagctggagtacgagagcggcatcccgcgcaacccgttcatcaacgcgggtgccctc
gtcgtcaccgaccgcctccacacccggacgggcgacgcggccggcgaactgctcgccttc
ctgcggtcggagagcggcaacccggacctggacttcgacgtggagatcgccgcctccgaa
acggcccatggggaccgcaacgcggccctcgcccacttcatggcctcgtacggcaacatc
gacaaccccgtaccggccctcctcgaccagtacttccggcagtgctccctcaccgcctcc
tgcgccgacctggccctcgcgaccaccttcctggcccgccacggcgtccgggccgacggc
acccgcctgctgacgcgcagccaggcgaaacaggtcaacgcggtcatgctcacctgcggg
acgtacgacgcggcgggcgagttcgcctaccgcgtcggcctgcccggcaagagcggtgtg
ggcggcggcatcatcgccgtcgtaccgggccgctgcgggctgtgcgtatggagtccgggg
ctggacgagcggggcaactcggtggcgggagtggcggcgctggaccggttcaccaccctg
acgggactgtcggtcttctga

DBGET integrated database retrieval system