KEGG   Streptomyces scabiei: SCAB_84901Help
Entry
SCAB_84901        CDS       T01187                                 

Gene name
echA19
Definition
enoyl CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
scb  Streptomyces scabiei
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SCAB_84901 (echA19)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCAB_84901 (echA19)
   00650 Butanoate metabolism
    SCAB_84901 (echA19)
  Lipid metabolism
   00071 Fatty acid degradation
    SCAB_84901 (echA19)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCAB_84901 (echA19)
   00310 Lysine degradation
    SCAB_84901 (echA19)
   00360 Phenylalanine metabolism
    SCAB_84901 (echA19)
   00380 Tryptophan metabolism
    SCAB_84901 (echA19)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCAB_84901 (echA19)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCAB_84901 (echA19)
   00281 Geraniol degradation
    SCAB_84901 (echA19)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCAB_84901 (echA19)
   00627 Aminobenzoate degradation
    SCAB_84901 (echA19)
   00930 Caprolactam degradation
    SCAB_84901 (echA19)
Enzymes [BR:scb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SCAB_84901 (echA19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9487445..9488245
Genome map
AA seq 266 aa AA seqDB search
MGGTEHLTVRREGGTLVLTLNRPEAKNALSLPMLVGLYDGWVRADEDEEIRSIVLTGAGG
AFCAGMDLKALAGKGMEGQQYRDRLKADPDLHWKAMLRHHRPRKPVIAAVEGHCVAGGTE
ILQGTDIRVAGESATFGLFEVRRGLFPIGGSTVRLQRQIPRTHALEMLLTGRPYSAQEAA
AIGLIGHVVPEGTALAKALEIAEQVNACGPLAVEAVKASVYETAEMTEAEGLAAELKRGW
PVFDTADAKEGARAFAEKRAPVYRRE
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcaccgaacacctcaccgtgcggcgcgaaggcggcacactggtgctcacgctc
aacaggcccgaagccaagaacgcgctctcgctgccgatgctcgtcggcctgtacgacggg
tgggtccgggccgacgaggacgaggagatccgctccatcgtcctcaccggagcgggcggc
gccttctgcgcgggcatggacctcaaggccctcgcgggcaaggggatggaggggcagcag
taccgggaccggctcaaggccgaccccgacctgcactggaaggccatgctccgccaccac
cggccgcgcaagccggtgatcgccgccgtcgaggggcactgcgtcgccggaggcaccgag
atcctccagggcaccgacatccgggtcgccggcgagtcggcgaccttcggcctcttcgag
gtccggcgcggactcttcccgatcggcggttccacggtccggctccagcggcagatcccg
cgcacgcacgccctggagatgctgctcaccgggcggccctacagcgcgcaggaggccgcc
gcgatcgggttgatcggacatgtggtgcccgagggcacggccctggccaaggccctggag
atcgccgaacaggtcaacgcgtgcgggccgcttgccgtcgaggccgtgaaggcgtccgtc
tacgagacggccgagatgaccgaggcggaggggctggcggccgagttgaagcgggggtgg
ccggtcttcgacacggccgatgcgaaggaaggggctcgtgccttcgccgagaagcgggcc
cctgtctaccggcgggaatag

DBGET integrated database retrieval system