KEGG   Streptomyces scabiei: SCAB_85681Help
Entry
SCAB_85681        CDS       T01187                                 

Gene name
melC2B
Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
scb  Streptomyces scabiei
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SCAB_85681 (melC2B)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SCAB_85681 (melC2B)
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     SCAB_85681 (melC2B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9585600..9586424)
Genome map
AA seq 274 aa AA seqDB search
MTIRKNQATLSADEKRRLVDALIALKRSGRYDEFVTTHNAFILGDTDNGERTGHRSPSFL
PWHRRFLLEFERALQSVDPAVALPYWDWTADRTTRSSLWAPDFLGGTGRSRDGQVMDGPF
AAATGNWPVTVRVDGRTYLRRSLGTAVRQLPTRAEVDSVLAMSTYDMAPWNSASDGFRNH
LEGWRGVNLHNRVHVWVGGQMGTGVSPNDPVFWLHHAFVDKLWADWQRLHPGSAYLPAAG
TPNVVDLNEPMRPWNDTTPAALLDHTAHYTFDAA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaccatacgcaagaaccaggcgaccctgagcgccgacgagaagcggcgccttgtcgac
gccctgatcgcgctgaagcgctccggccgctacgacgagttcgtcacgacgcacaacgcc
ttcatcctcggcgacaccgacaacggcgaacgcaccggccaccgttcaccgtcgttcctc
ccctggcaccgcagattcctgctggagttcgagcgggccctgcagtccgtcgacccggcc
gtcgcgctgccgtactgggactggaccgccgaccgcaccacccggtcctccctctgggcc
ccggacttcctcggcggcaccgggcgcagccgcgacggacaggtgatggacgggccgttc
gcggccgccaccggcaactggccggtcaccgtgcgcgtcgacggccgcacctacctgcgc
cgctccctcggcaccgcggtgcggcagttgccgacccgggccgaggtggactcggtgctc
gcgatgtccacgtacgacatggcgccctggaacagtgcctcggacggcttccgcaaccac
ctggagggctggcggggcgtcaacctgcacaaccgggtgcacgtctgggtcggcggccag
atgggcaccggggtctcccccaacgacccggtgttctggctgcaccacgccttcgtcgac
aagctgtgggcggactggcagcgtctgcaccccggttcggcgtacctgccggcggccggg
acgccgaacgtggtcgatctgaacgagccgatgaggccctggaacgacacgactccggcg
gcgctgctggaccacaccgcgcactacaccttcgacgccgcctga

DBGET integrated database retrieval system