KEGG   Streptomyces scabiei: SCAB_9321Help
Entry
SCAB_9321         CDS       T01187                                 

Definition
monooxygenase P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
scb  Streptomyces scabiei
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:scb00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:scb00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:scb00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1047461..1049002
Genome map
AA seq 513 aa AA seqDB search
MTATTAATAISGFRSAELGWPELHRIPHPPFRIPLLGDVLGTNVRTPVQESTRLGQRLGP
IFRRKAFGKEIVFVGGAELAAEMADEARFAKHVGVGVANLRPVAGDGLFTAYNHEPNWQL
AHDVLAPGFGREAMAGYHPMMLDVAERLIEHWDREETAGSAVDVPGDMTKLTLETIARTG
FGHDFGSFERTRPHPFVAAMVGTLTYAQQRNVVPDPLVPVLLRGAAQQNRADMAFLVETV
DAVVRARRSPGGGRGAGDGDLLDRMLETAHPETGERLSAENVRRQVITFLVAGHETTSGA
LSFALHYLARYPDLAARARAEVDRVWGDAARPGYEQVAKLRYVRRVLDEALRLWPTAPAF
SREAREDTVLGGVHPMRRGAWALVLTSMLHRDPEVWGADAERFDPDRFDAAAVRGRAPHT
FKPFGTGARACIGRQFALHEATLVLGLLLRRYELTPEPGYRLRVVERLTLMPDGLRLRVR
RRAGAGTDAPRTPSSPPTPSSAPSGRPVTGAGE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgacgacagcggccacggcgatcagcggcttccgcagcgccgagctgggctgg
cccgaactccaccggataccccacccgccgttccggatccccctcctcggcgacgtgctc
ggcaccaacgtgcgcacgccggtccaggagtcgacccggctcgggcagcgcctcggcccg
atcttccggcggaaggcgttcggcaaggagatcgtgttcgtcgggggcgcggaactcgcg
gccgagatggcggacgaggcccggttcgccaagcacgtgggcgtgggggtcgccaacctg
cggccggtggccggggacggcctcttcaccgcgtacaaccacgagccgaactggcagctg
gcgcacgacgtcctcgccccgggcttcggccgggaggccatggccggctaccacccgatg
atgctcgacgtcgccgaacggctgatcgagcactgggaccgcgaggagacggcgggctcc
gccgtggacgtgcccggcgacatgaccaagctgaccctggagacgatcgcccgcaccggc
ttcggccacgacttcggctccttcgagcgcacccgcccgcacccgttcgtcgccgccatg
gtcggcaccctgacctacgcacagcagcgcaacgtcgtccccgacccgctggtcccggtg
ctgctgcggggcgcggcccagcagaaccgggcggacatggcgttcctcgtcgagacggtc
gacgcggtggtgcgggcccggcgctccccgggcggtggccggggcgccggtgacggcgac
ctcctcgaccggatgctggagaccgcccacccggagaccggcgagcggctgtccgccgag
aacgtccggcgccaggtcatcaccttcctggtcgccgggcacgagaccacctccggcgcc
ctgtccttcgccctgcactacctcgcccggtacccggacctggccgcccgcgcccgcgcc
gaggtggaccgggtgtggggcgacgcggcgcggcccggctacgagcaggtcgccaagctg
cggtacgtgcgccgggtgctggacgaggcgctgcggctgtggccgaccgcgcccgccttc
tcgcgcgaggcccgcgaggacaccgtgctgggcggggtccacccgatgcggcggggcgcc
tgggcactggtgctgacgtcgatgctgcaccgggacccggaggtctggggcgcggacgcg
gagcggttcgacccggaccgcttcgacgcggcggccgtacgcggccgggccccgcacacc
ttcaagccgttcggcacgggggcgcgggcctgcatcggccgccagttcgcgctccacgag
gcgacgctggtgctgggcctgctgctgcgccggtacgagctgaccccggagccggggtac
cggctgcgggtggtggagcggctgacgctgatgccggacgggctgcggctgcgggtgcgg
cggcgggcgggcgcggggacggacgccccgcggactccgtcgtcgccgccgacgccgtcc
tcggcgccgtcaggccgtccagtgaccggggcgggtgagtga

DBGET integrated database retrieval system