KEGG   Streptomyces scabiei: SCAB_9321Help
Entry
SCAB_9321         CDS       T01187                                 

Definition
monooxygenase P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
scb  Streptomyces scabiei
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SCAB_9321
  Amino acid metabolism
   00380 Tryptophan metabolism
    SCAB_9321
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SCAB_9321
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SCAB_9321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1047461..1049002
Genome map
AA seq 513 aa AA seqDB search
MTATTAATAISGFRSAELGWPELHRIPHPPFRIPLLGDVLGTNVRTPVQESTRLGQRLGP
IFRRKAFGKEIVFVGGAELAAEMADEARFAKHVGVGVANLRPVAGDGLFTAYNHEPNWQL
AHDVLAPGFGREAMAGYHPMMLDVAERLIEHWDREETAGSAVDVPGDMTKLTLETIARTG
FGHDFGSFERTRPHPFVAAMVGTLTYAQQRNVVPDPLVPVLLRGAAQQNRADMAFLVETV
DAVVRARRSPGGGRGAGDGDLLDRMLETAHPETGERLSAENVRRQVITFLVAGHETTSGA
LSFALHYLARYPDLAARARAEVDRVWGDAARPGYEQVAKLRYVRRVLDEALRLWPTAPAF
SREAREDTVLGGVHPMRRGAWALVLTSMLHRDPEVWGADAERFDPDRFDAAAVRGRAPHT
FKPFGTGARACIGRQFALHEATLVLGLLLRRYELTPEPGYRLRVVERLTLMPDGLRLRVR
RRAGAGTDAPRTPSSPPTPSSAPSGRPVTGAGE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgacgacagcggccacggcgatcagcggcttccgcagcgccgagctgggctgg
cccgaactccaccggataccccacccgccgttccggatccccctcctcggcgacgtgctc
ggcaccaacgtgcgcacgccggtccaggagtcgacccggctcgggcagcgcctcggcccg
atcttccggcggaaggcgttcggcaaggagatcgtgttcgtcgggggcgcggaactcgcg
gccgagatggcggacgaggcccggttcgccaagcacgtgggcgtgggggtcgccaacctg
cggccggtggccggggacggcctcttcaccgcgtacaaccacgagccgaactggcagctg
gcgcacgacgtcctcgccccgggcttcggccgggaggccatggccggctaccacccgatg
atgctcgacgtcgccgaacggctgatcgagcactgggaccgcgaggagacggcgggctcc
gccgtggacgtgcccggcgacatgaccaagctgaccctggagacgatcgcccgcaccggc
ttcggccacgacttcggctccttcgagcgcacccgcccgcacccgttcgtcgccgccatg
gtcggcaccctgacctacgcacagcagcgcaacgtcgtccccgacccgctggtcccggtg
ctgctgcggggcgcggcccagcagaaccgggcggacatggcgttcctcgtcgagacggtc
gacgcggtggtgcgggcccggcgctccccgggcggtggccggggcgccggtgacggcgac
ctcctcgaccggatgctggagaccgcccacccggagaccggcgagcggctgtccgccgag
aacgtccggcgccaggtcatcaccttcctggtcgccgggcacgagaccacctccggcgcc
ctgtccttcgccctgcactacctcgcccggtacccggacctggccgcccgcgcccgcgcc
gaggtggaccgggtgtggggcgacgcggcgcggcccggctacgagcaggtcgccaagctg
cggtacgtgcgccgggtgctggacgaggcgctgcggctgtggccgaccgcgcccgccttc
tcgcgcgaggcccgcgaggacaccgtgctgggcggggtccacccgatgcggcggggcgcc
tgggcactggtgctgacgtcgatgctgcaccgggacccggaggtctggggcgcggacgcg
gagcggttcgacccggaccgcttcgacgcggcggccgtacgcggccgggccccgcacacc
ttcaagccgttcggcacgggggcgcgggcctgcatcggccgccagttcgcgctccacgag
gcgacgctggtgctgggcctgctgctgcgccggtacgagctgaccccggagccggggtac
cggctgcgggtggtggagcggctgacgctgatgccggacgggctgcggctgcgggtgcgg
cggcgggcgggcgcggggacggacgccccgcggactccgtcgtcgccgccgacgccgtcc
tcggcgccgtcaggccgtccagtgaccggggcgggtgagtga

DBGET integrated database retrieval system