KEGG   Sphaerochaeta coccoides: Spico_0021Help
Entry
Spico_0021        CDS       T01469                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
scc  Sphaerochaeta coccoides
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Spico_0021
Enzymes [BR:scc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Spico_0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21940..22899
Genome map
AA seq 319 aa AA seqDB search
MKEPLKIMIVGSFVVDLMARSETLPIPGQTVKGSFFKMGPGGKGSNQAVAAFRSGGDVSF
LTKIGRDLFSSVALDFYHSEKMDTSLVFKDATQNTGIALIMVDEKSQNSISVVPGACSSI
TFQEITKASGVLKRAKVFLTQLETNLDIIPYAVGKVRENQGTTILNPAPAQPLSDAFLAL
FDIITPNETEASILSGVKVVNRESAEKAADVLIGKGVKTVLITMGAQGVFLKERGSRSQF
FPALPVKVIDTTGAGDAFNGGLAVALSEEKSLQDSILFATAVAALSVTKIGTAPSMPLRT
EVDQFFSSVDKDAYFASIE
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacctttaaaaataatgattgttggaagttttgtggtagatttgatggctcgt
tctgaaacgctgcccataccaggacagacggtcaagggctcttttttcaagatggggcca
ggaggaaaaggttctaaccaggcagttgcggcatttcgttcaggaggagacgtatctttt
ttaacaaaaatcggaagggatcttttttcttctgttgcacttgatttctatcattctgaa
aagatggatacttcccttgtttttaaggatgctacgcagaacacaggaatcgcgcttata
atggtagatgaaaaatcacagaacagcatatcagtggttcctggcgcttgcagttccata
acttttcaggaaatcacgaaagcttccggagttttgaagcgtgccaaggtttttcttact
cagcttgaaacaaatttagatatcatcccctatgcagtaggaaaagtacgagaaaaccaa
ggaacgactattttgaatccagctccggctcaaccattatctgatgcgtttcttgctttg
tttgatatcatcacgccaaatgagacagaagcttcaattctctcaggagtcaaggttgtg
aaccgagaaagcgctgaaaaagccgcggacgtcctgataggcaaaggagtgaaaacagtt
ctcatcaccatgggggcgcaaggggttttcctaaaagaaagaggatcacggtcacaattt
tttccagcacttcctgtcaaggttatcgatacgacgggagccggggatgcctttaatggg
ggtcttgctgttgctctctccgaagaaaaaagccttcaggattcgattttgtttgccacg
gcggtagccgcgctttccgtgacgaaaattggtacagctccttctatgcctttgcggacg
gaggtcgatcagtttttttccagtgtggacaaggacgcctactttgcttctattgaatag

DBGET integrated database retrieval system