KEGG   Sphaerochaeta coccoides: Spico_0027Help
Entry
Spico_0027        CDS       T01469                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
scc  Sphaerochaeta coccoides
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Spico_0027
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Spico_0027
Enzymes [BR:scc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Spico_0027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29013..30314
Genome map
AA seq 433 aa AA seqDB search
MAQNQGGRYIIDGGRPVSGTVRISGNKNAALPCLAATLLAREPVTLRNIPRIADVGVMVE
LLEILGMRVENREPGVYHISGTPSVRDLPYTLVDAVRGSILLVGPLVARCGAVRLPPPGG
DVIGLRRLDTHFSVLEALGATCVLHDNGLLDVRTPSGLSGTDVFLDEASVTATENAVMAA
SVASGTTILRNAACEPHVQDLCSMLNQMGAKISGIGSNLLVIEGVAELHGCDFTIGYDYM
EAGSFIGLAAATRGTLILEGTDGHDVPMIRNGFARLGIEWESLAGNRLVVPAEQRLSIVR
TVNGGTPKLDDAPWPGFPADLLSIMTVVATQAKGNILIHEKMFESRMFFIDWLIRMGADI
ILCDPHRAVVTGPMALTPARLTSPDVRAGMALIIAALCAEGRSEIQNVYQVERGYEDLVG
KLKILGAAIERVE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaaccaaggcggccgctatatcattgacggaggcaggccggtatccgggact
gtccgcatcagtggcaacaagaatgcggcgcttccctgtcttgccgccacgctccttgcc
agggaaccggtgacgctgcgcaacattccacgcatagccgatgtcggcgtcatggtggag
ctgcttgagattcttgggatgcgggtggagaaccgggaaccgggagtctaccatatcagc
ggtacgccgtccgtccgtgaccttccttataccttggttgatgccgtgaggggatccata
cttcttgtcgggccattggttgcgcggtgcggagcggtacggcttccccctcccggtgga
gatgtcataggcctgcgtcggctggacactcatttctccgtgctggaagccttgggcgcc
acgtgcgtccttcatgacaacggtcttctggatgtccgcacgccatcaggactgtccgga
actgatgttttcctggacgaagcctctgtcaccgcgacagaaaatgccgtcatggccgcc
tcggtagcgtcaggaacgactatcctgcgcaatgccgcctgtgaaccgcatgtccaggat
ctctgctccatgctgaaccagatgggagcgaaaatcagcgggattggttctaatctcctt
gtcatagaaggcgtcgccgaactgcatggctgtgatttcaccattggctatgattacatg
gaggcaggttctttcattggacttgctgcggccacccgtgggactttaatcctggaaggg
actgatggtcatgatgttcccatgattcggaacggattcgcccggctgggaatagaatgg
gagtcccttgcagggaatcgtctcgttgttcccgcggagcagaggttgtccatagtcagg
acggtgaacggagggacgccgaaactggacgatgctccctggccgggattcccggcggat
ctgctgagcatcatgactgtcgtcgctacccaggcaaagggaaacatcctgatacatgaa
aagatgtttgagtcacggatgttcttcatcgactggttgattcggatgggggcggatatc
atcctctgtgatccccatagggcggtcgtcaccggccccatggccttgactccagctcgg
ctcaccagcccggatgtccgtgccggcatggcgttgataatagcggctctctgcgctgag
gggcgttcagagatacagaatgtctaccaggttgaacgcggatacgaggatcttgtaggc
aaattgaaaatcctgggagctgcaattgagagggtcgaataa

DBGET integrated database retrieval system