KEGG   Sphaerochaeta coccoides: Spico_0086Help
Entry
Spico_0086        CDS       T01469                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
scc  Sphaerochaeta coccoides
Pathway
scc00010  Glycolysis / Gluconeogenesis
scc01100  Metabolic pathways
scc01110  Biosynthesis of secondary metabolites
scc01120  Microbial metabolism in diverse environments
scc01130  Biosynthesis of antibiotics
scc01200  Carbon metabolism
scc01230  Biosynthesis of amino acids
Module
scc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
scc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spico_0086
Enzymes [BR:scc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Spico_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N NAD_binding_3 Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AEC01328
UniProt: F4GJ33
Position
100458..101492
Genome map
AA seq 344 aa AA seqDB search
MKKIKVGVAGYGVIGQRLADGVALQGDMELVGVADVAPTLSVKALKEKGMPYKFFTAAPE
RQAELEAAGIPVSGDLDDLVRQSDIMLDATSAGVGAKNKLLYEKYGKKAIFQGGEKNTVA
DVFFHGYANYEKGVGADFLKLTSCNTTGLIRAVDCLDRAVGVEKVAITIIRRVADPGDYH
RGLTNALQIDKAPSHQALDLMTIMPHVEATGILVHTPVTHGHIITVVLTPKKDISVAEAL
MYFDGHPRIRLVSIDEGFQGNASLFRYARDLGNPRGDMYEIAIWRDSIVKSGRDIMFAIN
IPQEAVVIPENIDAIRASMKMQLTRDEGTAETNTYLGIGKWKIS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattaaagtcggagttgcaggatatggcgtgatagggcaacgtctcgctgat
ggtgtcgcactccagggagatatggagcttgttggtgttgccgatgtagcccctacgctt
agcgtgaaggcgttgaaagaaaaggggatgccctacaagttctttacggctgctcctgaa
agacaggctgaacttgaggccgccggtattcctgtcagcggcgaccttgatgatttggtc
agacagtcggacatcatgcttgacgcgaccagtgccggcgtcggcgcaaagaacaagctt
ctctacgagaagtacgggaagaaagcaatattccagggcggagaaaagaacactgtcgcc
gatgtttttttccatggatatgcgaattatgaaaaaggagtgggagctgatttcctcaag
ctgacatcgtgcaatacgacagggttgatcagagctgtcgattgcctggacagggcggtc
ggcgtggagaaagtcgccattacaatcatacggagggtcgccgatcctggtgattatcat
cggggactgacgaacgccttgcagattgacaaggctccaagccaccaggcgctcgacctc
atgaccatcatgccgcatgtcgaagcaacaggaatccttgtccatactccagtcactcat
ggtcatatcatcaccgttgttctgactccaaagaaagacatcagtgttgcggaagctctc
atgtattttgacggacatcctcgtatcaggcttgtctcgatagatgaaggtttccaggga
aacgccagtctgttccgctatgcgcgtgacttgggaaatccacggggtgacatgtatgaa
attgcaatctggcgtgattcgatagtcaaaagcggtcgggacatcatgtttgccatcaac
atcccgcaggaagcggtcgtcattcctgaaaacatagatgccatccgtgcgtccatgaaa
atgcagcttacacgggacgagggaactgccgagacaaacacatatctggggattggaaaa
tggaagatttcgtaa

DBGET integrated database retrieval system