KEGG   Spirochaeta coccoides: Spico_0157Help
Entry
Spico_0157        CDS       T01469                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
scc  Spirochaeta coccoides
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spico_0157
   00500 Starch and sucrose metabolism
    Spico_0157
Enzymes [BR:scc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Spico_0157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(178299..179381)
Genome map
AA seq 360 aa AA seqDB search
MHDFPILKDIHDAHDASVAPAGLPVPEDSTRPCFTSITAALETGFSKVLIHPGIYREKLS
VNRDNVSFIGTDASSTIIVWDDAHRTLDGSGRKLSTSGSATVTLTGSHFSAHGLTFMNDF
DYPGESRKAPDSSSASGLQAVSVRVAGNADVTVFTSCAFIGYQDTLFLDAGRVWLKDCTI
SGHVDFIFGSSRAVMEDCLIICRQRDATEQGFICAPSTKADMPHGFLFLRCTLEKETSAV
TPGSYWLGRPWHPSGDTEVNPSACFISCLMDDHIHPEGWTSMHSRTPQGRERRWYPEESR
FCEYDTTGPGAPSTAPPARRCILDAMEALAWGRETVLSPWEDFTRPWPERDPLFSRTDIG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacttccctatcctgaaagatatccacgatgcacacgatgcatcagtcgctcca
gcgggattaccggttccggaggattccacacgaccatgcttcaccagcatcacagccgcc
ctggagacaggtttttccaaggtactgatccaccccggcatatatcgggagaagctgtcc
gttaacagggacaatgtcagtttcatcgggacggacgcttcttccaccatcattgtctgg
gacgatgcccaccggacgcttgacggttcaggacgcaagctcagcacatcaggaagcgca
acagtcaccctgactggatcccacttttcagcgcatgggctgacattcatgaatgacttt
gattatcccggagaatcccgaaaggctccggacagcagttcggcaagcggactacaggcg
gtgtccgtccgtgtcgcgggaaacgcggatgtcacggtcttcaccagctgcgcgttcatc
ggctatcaggatacgctctttcttgatgcgggacgggtatggttgaaagattgcacgatc
agcggtcatgtggacttcatcttcggcagctcccgtgccgtcatggaggattgcctcatc
atctgccgccagagggatgccaccgaacaaggtttcatctgcgcaccatccaccaaggcg
gacatgccccatggtttcctgttcctccgctgtacccttgagaaggaaacgtccgcagtc
actcccggctcatactggctgggcaggccatggcatccctccggagatacggaagtcaac
cccagcgcatgcttcatctcctgcttgatggatgaccacatccatccggaaggctggaca
agcatgcacagcagaactccccaaggacgtgaaagacgctggtatcccgaagaatcacgt
ttttgtgaatacgacaccacaggtcccggagccccgtccacggcgcctcctgcccgccgc
tgtatcctcgatgcgatggaagcactggcatggggacgggaaacagtcctgtccccatgg
gaggatttcacccgcccctggccagaaagagatcctctctttagccgaacagatattggt
tga

DBGET integrated database retrieval system