KEGG   Sphaerochaeta coccoides: Spico_0158Help
Entry
Spico_0158        CDS       T01469                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
scc  Sphaerochaeta coccoides
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Spico_0158
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Spico_0158
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Spico_0158
Enzymes [BR:scc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Spico_0158
Exosome [BR:scc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spico_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
179539..181281
Genome map
AA seq 580 aa AA seqDB search
MKKKVLLFLAAMVFAAASLQAVTIYPLDKAEILAGARFDFKVEFDEIQKNVDVDVTINGK
NYSSTIGRRSALVTEKDEAGMSASALIVRDVTLPAGKYVVSAAVNGKIAKSVTWTVNEQA
EQAVARNVIVLVADGLSIGHRTAARLLSRGNVEGTSQGLLNMDKMDRLGTMGTSSVDAIT
VDSANSMSAYMTGHKSSINALGVYADRTSDPFDDPKQENLAEIIRRTTKKSIGIVSDAEL
QDATPAAVVGHTRRRAEKSALMSSFLDVMPEVILGGGSAYFIPKSVQGSKRTDEINYVSE
FQKAGYQFITSNTELSKLRGIAAPDRLLGLFATGNMDGHLDRTLTKGKGWSAQFTDQPDL
TTMTQVALDVLSKNKEGFMLVVEAALVDKYTHPMDWERAVYDTIMFDKVIGIAQDFQKEN
PDTLIVVTGDHTHSISVYGTVNDDRPGDRLRDKVGTYANAGFPNYVDADGDGYPDTPDVS
IRLAVGFGNHPDYYETFKPHLDGVFAPAIANEKGDYVANAQYKDKGIFMEGNLDYTESQE
VHSVDDQLLSMSGPGSEQVKAYQENTAVFHYIAQALGLQP
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaagtattgttgtttcttgcagcgatggtctttgccgcagccagtttgcag
gccgtgaccatatacccgctggacaaggcagagattcttgccggtgcgcgttttgacttc
aaagttgaatttgatgaaatccagaagaacgtggatgtcgatgtgaccatcaatggcaaa
aattactcatctacaatcggcaggcgttctgccctcgtcacagaaaaagatgaagcaggc
atgtccgcttccgcgctgattgtccgtgatgttacgcttcctgcggggaaatatgtggtc
agcgccgctgtcaacgggaagattgccaagagcgtcacgtggactgtcaatgagcaggct
gaacaagctgtcgcccgcaacgtcatcgtcctggtcgccgacggactgtccattggccac
cgcaccgccgcccgtctgttgtccaggggcaatgtggagggaacatcccaaggcttgctc
aacatggacaagatggatcgtcttggcacaatgggaaccagctccgttgatgccatcacc
gtggacagcgccaactcgatgagcgcctacatgaccggacacaagtccagcatcaacgct
ttgggcgtctatgccgaccgcacctccgatcctttcgatgatccgaaacaagagaacctt
gctgaaatcatccgtcgcacgacgaagaaatccatcggcatcgtgtctgacgccgaactc
caggatgccacacccgccgctgtggtcggccacacccgccgccgcgccgagaagtccgct
ctgatgagttccttcctcgatgtcatgcctgaagtcattcttggtggaggcagcgcctac
ttcatcccgaaatcagtccagggttccaagcgtactgatgaaatcaactacgtctccgaa
ttccaaaaagctggctaccagttcatcacgagcaacacagagctgtccaagcttcgtggc
atcgcggctcctgacaggctccttggactttttgctaccggcaacatggacggacacctc
gaccgtacccttaccaaaggcaagggatggtcagcacagttcaccgaccagcctgacctc
accacgatgacccaggtcgccttggatgtcctgtccaagaacaaggaaggtttcatgctc
gtcgtcgaggccgccttggttgacaagtacacgcacccgatggattgggaacgcgccgtg
tacgacaccatcatgttcgacaaggttatcggcattgcccaagatttccaaaaggagaat
cctgatacgctcatcgtcgtcaccggcgaccatactcactcaatcagtgtctacggcacg
gtcaacgacgacagacctggcgacaggctccgagataaggtcggcacatatgctaacgcc
ggtttcccgaactatgtcgatgctgacggcgacggatatcccgacacgccggatgtctca
attcgccttgcggtcggttttggcaaccatcctgactactatgagaccttcaaaccgcat
cttgacggagtgtttgcccctgctattgcgaacgagaagggtgactatgtggccaatgca
cagtacaaggacaagggaatcttcatggaaggcaaccttgactataccgagtcccaggaa
gtccactctgtcgatgaccagcttctttcaatgagcggtccgggcagcgagcaggtcaag
gcatatcaggagaacacggcagtgttccactatattgcccaggctcttggcctccagccg
taa

DBGET integrated database retrieval system