KEGG   Sphaerochaeta coccoides: Spico_0424Help
Entry
Spico_0424        CDS       T01469                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
scc  Sphaerochaeta coccoides
Pathway
scc00010  Glycolysis / Gluconeogenesis
scc00260  Glycine, serine and threonine metabolism
scc00680  Methane metabolism
scc01100  Metabolic pathways
scc01110  Biosynthesis of secondary metabolites
scc01120  Microbial metabolism in diverse environments
scc01130  Biosynthesis of antibiotics
scc01200  Carbon metabolism
scc01230  Biosynthesis of amino acids
Module
scc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
scc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spico_0424
  Energy metabolism
   00680 Methane metabolism
    Spico_0424
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spico_0424
Enzymes [BR:scc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Spico_0424
Membrane trafficking [BR:scc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Spico_0424
Exosome [BR:scc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Spico_0424
  Exosomal proteins of melanoma cells
   Spico_0424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEC01652
UniProt: F4GIE4
Position
498161..498910
Genome map
AA seq 249 aa AA seqDB search
MYKLVLVRHGESEWNRENRFTGWTDVDLSEKGEKEAAMAGELLKKEGYAFDIAFTSVLTR
ANRTLNLILDKMGLSWIPVVKNWRLNERHYGSLQGLNKADTAAKYGDDQVKIWRRAYDIA
PPPLAEDDERYPGRDPRYAGLDKKDLPLTECLKDTVKRAIPFWNDEIAPAIKSGKKVIVA
AHGNSLRALVKYLDGIGDDEIVNLNIPTGVPLVYELDGDLKPVKHYYLGDAAAVEAAMAA
VAAQGKSKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaattagttcttgtgcgtcacggggaaagtgaatggaaccgtgagaaccgtttt
accgggtggacagatgtggatctttctgaaaaaggcgagaaggaagcggccatggcaggc
gagctcttgaaaaaggaaggctatgcatttgacattgcgttcacatccgtgctgacccgc
gcgaaccgcaccttgaacctgatcttggataagatgggtctttcatggattcccgttgta
aagaactggaggctgaacgaacgccattatggctcccttcagggactcaacaaagccgat
accgccgccaaatatggtgacgaccaggtgaagatatggcgtcgcgcttatgatattgct
cccccgcctcttgccgaggatgatgagcgttatcctggccgtgacccccggtacgccggg
ttggacaagaaggatctgccgcttaccgaatgcctgaaggataccgtaaagcgggcgatt
cctttctggaacgatgagattgctcctgccatcaagagcgggaagaaggtgattgtcgct
gcccatggcaacagtctccgtgcgctggtgaagtatcttgacggcatcggcgatgatgag
attgtcaatctgaacatcccgaccggggttccccttgtatatgagctggatggggacttg
aagcctgttaagcattattatctgggtgacgccgccgcggtggaagctgccatggctgct
gttgccgcccagggaaagagcaagaaataa

DBGET integrated database retrieval system