KEGG   Sphaerochaeta coccoides: Spico_0424Help
Entry
Spico_0424        CDS       T01469                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
scc  Sphaerochaeta coccoides
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spico_0424
   01230 Biosynthesis of amino acids
    Spico_0424
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spico_0424
  Energy metabolism
   00680 Methane metabolism
    Spico_0424
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spico_0424
Enzymes [BR:scc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Spico_0424
Exosome [BR:scc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Spico_0424
  Exosomal proteins of melanoma cells
   Spico_0424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
498161..498910
Genome map
AA seq 249 aa AA seqDB search
MYKLVLVRHGESEWNRENRFTGWTDVDLSEKGEKEAAMAGELLKKEGYAFDIAFTSVLTR
ANRTLNLILDKMGLSWIPVVKNWRLNERHYGSLQGLNKADTAAKYGDDQVKIWRRAYDIA
PPPLAEDDERYPGRDPRYAGLDKKDLPLTECLKDTVKRAIPFWNDEIAPAIKSGKKVIVA
AHGNSLRALVKYLDGIGDDEIVNLNIPTGVPLVYELDGDLKPVKHYYLGDAAAVEAAMAA
VAAQGKSKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaattagttcttgtgcgtcacggggaaagtgaatggaaccgtgagaaccgtttt
accgggtggacagatgtggatctttctgaaaaaggcgagaaggaagcggccatggcaggc
gagctcttgaaaaaggaaggctatgcatttgacattgcgttcacatccgtgctgacccgc
gcgaaccgcaccttgaacctgatcttggataagatgggtctttcatggattcccgttgta
aagaactggaggctgaacgaacgccattatggctcccttcagggactcaacaaagccgat
accgccgccaaatatggtgacgaccaggtgaagatatggcgtcgcgcttatgatattgct
cccccgcctcttgccgaggatgatgagcgttatcctggccgtgacccccggtacgccggg
ttggacaagaaggatctgccgcttaccgaatgcctgaaggataccgtaaagcgggcgatt
cctttctggaacgatgagattgctcctgccatcaagagcgggaagaaggtgattgtcgct
gcccatggcaacagtctccgtgcgctggtgaagtatcttgacggcatcggcgatgatgag
attgtcaatctgaacatcccgaccggggttccccttgtatatgagctggatggggacttg
aagcctgttaagcattattatctgggtgacgccgccgcggtggaagctgccatggctgct
gttgccgcccagggaaagagcaagaaataa

DBGET integrated database retrieval system