KEGG   Sphaerochaeta coccoides: Spico_0430Help
Entry
Spico_0430        CDS       T01469                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
scc  Sphaerochaeta coccoides
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spico_0430
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spico_0430
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Spico_0430
Enzymes [BR:scc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Spico_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
505920..507185
Genome map
AA seq 421 aa AA seqDB search
MKFFSTRKKAPHVNLGESLLTGLAPDGGLYVPETIPARDFREYFPSSFPALAADVLSPFF
EKDPLASSLDDICASAFNFPVPLHSLGDDREVLELFHGPTAAFKDFGARFLARSMEKELV
RSGRTLTILVATSGDTGGAVAAAFHGCRGINVKVLFPKGRVSARQKRQLTCWGDNISAYE
VEGSFDDCQKMVKDAFMDKDVSRRERLSSANSINLGRLLPQMTYYVHSALEFKKKHGANP
LVIVPSGNVGNSCAGYWAKTSGAPIARIALAVNANSTIVDFLSSGRYEPRPSVATLANAM
DVGAPSNMERLQELFPSFKEFSANVTAWSVSDEHIRETIGKTWENDRYVMCPHTATAEYV
RLTHFPREKSIIVSTAHPAKFETIVEPLVGHSVAVPDSLAVLLEKKETYQSIPADHHLLF
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttttttcgacacggaagaaagcgccgcacgtgaacctgggagaatctctgctg
accggattggctcctgatggcggtctatatgttcctgaaaccattcctgccagggatttc
cgggaatatttcccatcatcatttcctgctctggcggcggatgtcctgtcgccattcttt
gagaaagatccacttgcttcaagtctggacgatatttgtgcatcggctttcaattttcct
gtccctctccatagcttgggagatgatcgagaggtcttggaattgtttcatgggcctact
gcggccttcaaggatttcggggcacgtttcttggcacgttccatggagaaagagcttgtc
cgttccggacgcactctgaccatattggtggctaccagcggtgatacgggaggagcggtg
gctgcggcgttccatggatgcagaggaattaacgtgaaggtgcttttccccaagggacgg
gtttccgcccgacagaaacggcagctgacctgttggggggacaatatttcagcatatgaa
gtcgaaggttcattcgatgactgtcagaaaatggtcaaggatgctttcatggacaaggat
gtttcccgtagagagaggctgtcaagtgcgaacagcatcaatcttggacggcttctgcct
caaatgacgtattacgtacatagtgccttggaattcaagaaaaaacatggtgcgaatcct
ctggtcattgttcctagcggtaatgtcgggaatagttgcgctggttactgggcaaagact
tcaggcgctcctattgcgcgtatcgccttggctgtaaatgcgaatagcacaatcgttgac
tttctttccagcggacgatatgaaccacgccccagcgtggcgacattggcgaacgcgatg
gatgtgggagccccctcaaacatggaaaggctccaggagctgtttccgagctttaaggaa
ttttccgcaaacgtcactgcctggagtgtctcggacgaacacattagagaaacaatcggg
aaaacgtgggaaaatgaccggtatgtcatgtgtccgcatacggcaaccgctgaatatgtc
agactgacacacttccccagagaaaagagtatcattgtctcaacggctcatccggcgaag
tttgagaccatagtggaacctctggtagggcattctgtcgctgttcctgactcattggcg
gttttgcttgaaaagaaagagacgtatcagtcgattccggctgaccatcatctccttttt
gcatga

DBGET integrated database retrieval system