KEGG   Sphaerochaeta coccoides: Spico_0430Help
Entry
Spico_0430        CDS       T01469                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
scc  Sphaerochaeta coccoides
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spico_0430
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spico_0430
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Spico_0430
Enzymes [BR:scc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Spico_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
505920..507185
Genome map
AA seq 421 aa AA seqDB search
MKFFSTRKKAPHVNLGESLLTGLAPDGGLYVPETIPARDFREYFPSSFPALAADVLSPFF
EKDPLASSLDDICASAFNFPVPLHSLGDDREVLELFHGPTAAFKDFGARFLARSMEKELV
RSGRTLTILVATSGDTGGAVAAAFHGCRGINVKVLFPKGRVSARQKRQLTCWGDNISAYE
VEGSFDDCQKMVKDAFMDKDVSRRERLSSANSINLGRLLPQMTYYVHSALEFKKKHGANP
LVIVPSGNVGNSCAGYWAKTSGAPIARIALAVNANSTIVDFLSSGRYEPRPSVATLANAM
DVGAPSNMERLQELFPSFKEFSANVTAWSVSDEHIRETIGKTWENDRYVMCPHTATAEYV
RLTHFPREKSIIVSTAHPAKFETIVEPLVGHSVAVPDSLAVLLEKKETYQSIPADHHLLF
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttttttcgacacggaagaaagcgccgcacgtgaacctgggagaatctctgctg
accggattggctcctgatggcggtctatatgttcctgaaaccattcctgccagggatttc
cgggaatatttcccatcatcatttcctgctctggcggcggatgtcctgtcgccattcttt
gagaaagatccacttgcttcaagtctggacgatatttgtgcatcggctttcaattttcct
gtccctctccatagcttgggagatgatcgagaggtcttggaattgtttcatgggcctact
gcggccttcaaggatttcggggcacgtttcttggcacgttccatggagaaagagcttgtc
cgttccggacgcactctgaccatattggtggctaccagcggtgatacgggaggagcggtg
gctgcggcgttccatggatgcagaggaattaacgtgaaggtgcttttccccaagggacgg
gtttccgcccgacagaaacggcagctgacctgttggggggacaatatttcagcatatgaa
gtcgaaggttcattcgatgactgtcagaaaatggtcaaggatgctttcatggacaaggat
gtttcccgtagagagaggctgtcaagtgcgaacagcatcaatcttggacggcttctgcct
caaatgacgtattacgtacatagtgccttggaattcaagaaaaaacatggtgcgaatcct
ctggtcattgttcctagcggtaatgtcgggaatagttgcgctggttactgggcaaagact
tcaggcgctcctattgcgcgtatcgccttggctgtaaatgcgaatagcacaatcgttgac
tttctttccagcggacgatatgaaccacgccccagcgtggcgacattggcgaacgcgatg
gatgtgggagccccctcaaacatggaaaggctccaggagctgtttccgagctttaaggaa
ttttccgcaaacgtcactgcctggagtgtctcggacgaacacattagagaaacaatcggg
aaaacgtgggaaaatgaccggtatgtcatgtgtccgcatacggcaaccgctgaatatgtc
agactgacacacttccccagagaaaagagtatcattgtctcaacggctcatccggcgaag
tttgagaccatagtggaacctctggtagggcattctgtcgctgttcctgactcattggcg
gttttgcttgaaaagaaagagacgtatcagtcgattccggctgaccatcatctccttttt
gcatga

DBGET integrated database retrieval system