KEGG   Sphaerochaeta coccoides: Spico_0473Help
Entry
Spico_0473        CDS       T01469                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
scc  Sphaerochaeta coccoides
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spico_0473
   01230 Biosynthesis of amino acids
    Spico_0473
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spico_0473
   00051 Fructose and mannose metabolism
    Spico_0473
   00562 Inositol phosphate metabolism
    Spico_0473
Enzymes [BR:scc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Spico_0473
Exosome [BR:scc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Spico_0473
  Exosomal proteins of bladder cancer cells
   Spico_0473
  Exosomal proteins of melanoma cells
   Spico_0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
559087..559845
Genome map
AA seq 252 aa AA seqDB search
MRRYYIAGNWKMNLTPSEGALYAAELAKAVQKGKPDAKVMIAPAFVAIPAVLEAVKGSPI
IVAAQNAADHLSGAYTGEVSLSMLKDLGVGTVILGHSERRAIYGESDALINAKTKLALSE
GFEVILCVGETLEEREAGKLEDVLSRQVKIGLGGVSSADMSRVVIAYEPVWAIGTGKTAT
PDDADNAHAYIRGLINGLYGKDVAEQLIIQYGGSVKADNVKELMAKPNVDGALVGGASLS
IDKFLPIIEFGL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatactatatcgccggaaactggaagatgaacttgactccttcagaaggagcg
ctttatgccgctgagcttgcgaaagcggtacaaaagggcaagcctgacgcgaaggtcatg
attgcgccagctttcgttgcgattccggctgtccttgaggctgtgaaggggagtccgatc
atcgttgctgcccagaatgccgctgaccatctttccggtgcttataccggggaagtttcc
ctgtccatgctgaaggatctgggagtcgggacggtaatactgggacacagtgaacgccgc
gcaatctacggtgagtcagatgctttgattaatgccaagactaaacttgccttgtccgaa
ggtttcgaggtcatcctctgtgtcggtgaaactctggaagaaagagaggccggaaagttg
gaagatgtcctctcccggcaggtaaagataggtcttgggggagtatcttccgctgatatg
tctcgcgtggtcattgcttatgaacctgtctgggctatcggtaccggaaagactgccact
cctgatgatgctgacaatgctcatgcctatatccgtggactcatcaatggactttatggt
aaagatgttgcagaacagctcataatacagtatggtggttcggtaaaggcagataatgtg
aaggagctcatggccaagcctaatgttgatggcgctttggtcggcggggcatcactttcc
attgataagttcctgcctatcatcgaattcggtctctga

DBGET integrated database retrieval system